Luteitalea sp. TBR-22: TBR22_A48370 Help Entry TBR22_A48370      CDS       T09892                                  Name (GenBank) ribose 5-phosphate isomerase B   KO K01808   ribose 5-phosphate isomerase B [EC:5.3.1.6] Organism lub  Luteitalea sp. TBR-22 Pathway lub00030   Pentose phosphate pathway lub00051   Fructose and mannose metabolism lub00710   Carbon fixation by Calvin cycle lub01100   Metabolic pathways lub01110   Biosynthesis of secondary metabolites lub01120   Microbial metabolism in diverse environments lub01200   Carbon metabolism lub01230   Biosynthesis of amino acids Module lub_M00004   Pentose phosphate pathway (Pentose phosphate cycle) lub_M00007   Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P Brite KEGG Orthology (KO) [BR:lub00001]  09100 Metabolism   09101 Carbohydrate metabolism    00030 Pentose phosphate pathway     TBR22_A48370    00051 Fructose and mannose metabolism     TBR22_A48370   09102 Energy metabolism    00710 Carbon fixation by Calvin cycle     TBR22_A48370 Enzymes [BR:lub01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.1  Interconverting aldoses and ketoses, and related compounds     5.3.1.6  ribose-5-phosphate isomerase      TBR22_A48370 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LacAB_rpiB Gly_rich_SFCGS DUF2000 Motif Other DBs NCBI-ProteinID:  BCS35603 UniProt:  A0A915ULM9 LinkDB All DBs Position 5843606..5844055 Genome browser AA seq 149 aa AA seqDB search MRVALGADHAGVHLKEAVHSLLQSRGIDVHDFGTVGEASVDYPDYAAKVGRAVASGEADL GILACGTGLGMAIAANKIAGVRAAPVVDLESARLAREHNDANVLALGARVTSPEMALQIV AIFLDTSFAGGRHQRRLDKITALDNDRHC NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atgcgcgtggcgctgggcgcggatcatgcaggcgtccacctcaaggaagcggtgcactcg ctgctgcagtcacgcggcatcgacgtccacgacttcggcacggtgggcgaagcctcggtc gactatccggactacgcggcgaaggtcggtcgcgccgtggcgtcgggcgaggccgacctc ggcatcctggcctgcggcaccggcctcgggatggcgatcgcggccaacaagatcgcgggc gtgcgtgccgcgcccgtcgtcgacctcgagagcgcgcgattggcgcgcgagcacaacgac gccaacgtcctggcgctgggggcgcgggtcacttcgcccgagatggcgctgcagatcgtg gcgatcttcctcgacacttccttcgcgggcgggcgccaccagcgccgcctggacaagatc acggcgctcgacaacgaccgtcattgctag

DBGET integrated database retrieval system