Solilutibacter oculi: DCD74_00110 Help Entry DCD74_00110       CDS       T05527                                  Name (GenBank) TIGR02449 family protein   KO K09892   cell division protein ZapB Organism lue  Solilutibacter oculi Brite KEGG Orthology (KO) [BR:lue00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:lue03036]     DCD74_00110 Chromosome and associated proteins [BR:lue03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     DCD74_00110 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB Stathmin Crescentin SKA2 Mod_r YabA UPF0242 FUSC GapR_DNA-bd TMPIT RH1 DUF4407 bZIP_2 Motif Other DBs NCBI-ProteinID:  AXA83306 UniProt:  A0A344J2P6 LinkDB All DBs Position complement(16396..16617) Genome browser AA seq 73 aa AA seqDB search MDALDPFDRLMQLIERIETMAERQQRLGEENRSLRQQQEQLIHDRAQLVSRNEEARTRVE AMIQRLKALEQHT NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atggacgcactcgacccctttgaccgcctgatgcagctcatcgagcgcatcgagaccatg gccgaacgccagcagcgactgggcgaggaaaaccgcagcctgcgccagcagcaggagcag ctcatccacgaccgcgcgcagctggtcagccgcaacgaggaagcgcgcacccgcgtggaa gcgatgatccagcggctcaaggcgctggagcagcacacgtga

DBGET integrated database retrieval system