Solilutibacter oculi: DCD74_10485 Help Entry DCD74_10485       CDS       T05527                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism lue  Solilutibacter oculi Pathway lue01100   Metabolic pathways lue01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:lue00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DCD74_10485    00074 Mycolic acid biosynthesis     DCD74_10485   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DCD74_10485 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AXA85052 UniProt:  A0A344J7P2 LinkDB All DBs Position complement(2173143..2173409) Genome browser AA seq 88 aa AA seqDB search MSSQTEAERELAELLVESLNLDDVAADSIDPEAPLFNTGLGLDSIDALELALAISKKYGF QLRSDNEDNRRIFASLRALSEHIQQHRA NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgtccagccaaaccgaagccgaacgcgaactcgccgaattgctggtcgaaagcctgaat ctcgacgacgtcgcggccgacagcatcgatcccgaagccccgctgttcaacaccggcctg ggcctggattcgatcgacgcgctggaactggcgctggccatctccaagaaatacggcttc cagctgcgctcggacaacgaggacaaccgccgcatcttcgcctcgctgcgcgcgctctcc gaacacatccagcaacaccgcgcctga

DBGET integrated database retrieval system