Luteimonas granuli: FPZ22_08050 Help Entry FPZ22_08050       CDS       T06154                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism lug  Luteimonas granuli Pathway lug01100   Metabolic pathways lug01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:lug00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FPZ22_08050    00074 Mycolic acid biosynthesis     FPZ22_08050   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FPZ22_08050 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QDW66852 UniProt:  A0A518N4K6 LinkDB All DBs Position 1756099..1756368 Genome browser AA seq 89 aa AA seqDB search MTSIQSPAERELAELLVEALSLDEVDPASIDPEAPLFNAGLGLDSIDALELALAVGKRYG FQLRSDNEENRRIFASLRALSAHVEANRA NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgaccagcatccagtcccccgccgaacgcgaactcgcagaactcctggtcgaggccctg agcctggacgaggtcgatccggcctcgatcgatcccgaggcgccgctgttcaacgccggc ctgggcctggattccatcgatgcgctggagctggcgctggcggtgggcaagcgctatggc ttccagctgcgctcggacaacgaagagaaccgccgcatcttcgcctcgctgcgcgcgctg tccgcgcacgtcgaagccaaccgcgcctga

DBGET integrated database retrieval system