Luteimonas chenhongjianii: CNR27_01070 Help Entry CNR27_01070       CDS       T05077                                  Name (GenBank) acetolactate synthase   KO K11258   acetolactate synthase II small subunit [EC:2.2.1.6] Organism lum  Luteimonas chenhongjianii Pathway lum00290   Valine, leucine and isoleucine biosynthesis lum00650   Butanoate metabolism lum00660   C5-Branched dibasic acid metabolism lum00770   Pantothenate and CoA biosynthesis lum01100   Metabolic pathways lum01110   Biosynthesis of secondary metabolites lum01210   2-Oxocarboxylic acid metabolism lum01230   Biosynthesis of amino acids Module lum_M00019   Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine lum_M00570   Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine Brite KEGG Orthology (KO) [BR:lum00001]  09100 Metabolism   09101 Carbohydrate metabolism    00650 Butanoate metabolism     CNR27_01070    00660 C5-Branched dibasic acid metabolism     CNR27_01070   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     CNR27_01070   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     CNR27_01070 Enzymes [BR:lum01000]  2. Transferases   2.2  Transferring aldehyde or ketonic groups    2.2.1  Transketolases and transaldolases     2.2.1.6  acetolactate synthase      CNR27_01070 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACT_5 Motif Other DBs NCBI-ProteinID:  ATD66211 UniProt:  A0A290XAW5 LinkDB All DBs Position 248086..248322 Genome browser AA seq 78 aa AA seqDB search MHYQCEMTLRRAEGALVRVLGTTERRGFRPVSFEGDTHGHSEHWKLRMTVEGDRPAGSLQ GQLAKLYDCVSVEVSQCR NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgcattaccagtgtgagatgaccctgcgccgcgccgaaggcgcgctggtgcgcgtgctc ggcacgaccgagcgccgcggcttccgcccggtctcgttcgagggcgacacgcacggtcac agcgagcactggaagctgcgcatgaccgtcgagggcgaccgccccgcgggcagcttgcag ggccagctggccaagctctacgactgcgtctcggtggaggtgtcgcagtgtcgttga

DBGET integrated database retrieval system