Luteimonas chenhongjianii: CNR27_04045 Help Entry CNR27_04045       CDS       T05077                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism lum  Luteimonas chenhongjianii Pathway lum01100   Metabolic pathways lum01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:lum00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CNR27_04045    00074 Mycolic acid biosynthesis     CNR27_04045   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CNR27_04045 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ATD66721 UniProt:  A0A290XCC0 LinkDB All DBs Position 896689..896958 Genome browser AA seq 89 aa AA seqDB search MSAQTEAERALADLLVESLNLEDVQAADIDPEAPLFNAGLGLDSIDALELALAISKRYGF QLRSDNDENRKIFASLRALSAHVEQHRTT NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgtccgcacaaaccgaagccgaacgcgcgctggccgacctgctggtcgagagcctgaac ctcgaggacgtgcaagcggccgacatcgatcccgaggctccgctgttcaatgccggcctc ggcctggactcgatcgacgcgctggaactcgcgctggcgatcagcaagcgctacggcttc cagctgcgctccgacaacgacgagaaccgcaagatcttcgcctcgctgcgcgccctgtcg gcgcacgtcgagcagcaccgcaccacttga

DBGET integrated database retrieval system