Luteimonas chenhongjianii: CNR27_07980 Help Entry CNR27_07980       CDS       T05077                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism lum  Luteimonas chenhongjianii Pathway lum01100   Metabolic pathways lum01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:lum00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CNR27_07980    00074 Mycolic acid biosynthesis     CNR27_07980   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CNR27_07980 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Motif Other DBs NCBI-ProteinID:  ATD67379 UniProt:  A0A290XE68 LinkDB All DBs Position 1744390..1744629 Genome browser AA seq 79 aa AA seqDB search MSNIEERVKKIVIEQLGVKEEEVSNSASFVDDLGADSLDTVELVMALEEEFECEIPDEEA EKITSVQQAIDYVKAHAKG NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcaacatcgaagagcgcgtcaagaaaatcgtcatcgagcagctgggcgtcaaggaa gaagaagtcagcaacagcgcttccttcgtcgacgacctcggtgccgattccctcgacacc gtcgagctggtgatggcgctggaagaagaattcgagtgcgagattccggacgaagaagcc gagaagatcacctcggtgcagcaggcgatcgactacgtcaaggcgcacgccaagggctga

DBGET integrated database retrieval system