Luteimonas yindakuii: E5843_12900
Help
Entry
E5843_12900 CDS
T05957
Name
(GenBank) response regulator
KO
K03413
two-component system, chemotaxis family, chemotaxis protein CheY
Organism
lus
Luteimonas yindakuii
Pathway
lus02020
Two-component system
lus02030
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:
lus00001
]
09130 Environmental Information Processing
09132 Signal transduction
02020 Two-component system
E5843_12900
09140 Cellular Processes
09142 Cell motility
02030 Bacterial chemotaxis
E5843_12900
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02022 Two-component system [BR:
lus02022
]
E5843_12900
02035 Bacterial motility proteins [BR:
lus02035
]
E5843_12900
Two-component system [BR:
lus02022
]
CheA family
CheA-CheYBV (chemotaxis)
E5843_12900
Bacterial motility proteins [BR:
lus02035
]
Flagellar system
Chemotaxis proteins
Two component system proteins
E5843_12900
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Response_reg
Motif
Other DBs
NCBI-ProteinID:
QCO68437
LinkDB
All DBs
Position
2659045..2659413
Genome browser
AA seq
122 aa
AA seq
DB search
MSGRPTVLLCDDSRALRMLAAGQLDEAGFDVAGEAGNGLEAIRQYEALRPDLVLLDLVMP
ECDGREALARILELDPQARVVILSSLGAQRDIEECLRIGARSYLQKPIDTDAMERVLREA
LA
NT seq
369 nt
NT seq
+upstream
nt +downstream
nt
atgagcggacgaccgaccgtgctgttgtgcgacgactcgcgcgcgctgcgcatgctcgcg
gcagggcagctggacgaagccggcttcgacgtggcgggcgaggccggcaacggcctggag
gcgatccgccagtacgaggccctgcggccggacctggtgctgctggacctggtgatgccc
gaatgcgacgggcgcgaggcgctggcgcgcatcctcgaactcgacccgcaggcgcgggtg
gtgatcctcagctcgctgggcgcgcagcgcgacatcgaggagtgcctgcgcatcggcgcg
cgctcctacctgcagaagcccatcgacaccgacgcgatggagcgcgtgctgcgcgaggcg
ctcgcctga
DBGET
integrated database retrieval system