KEGG   Luteimonas yindakuii: E5843_12900
Entry
E5843_12900       CDS       T05957                                 
Name
(GenBank) response regulator
  KO
K03413  two-component system, chemotaxis family, chemotaxis protein CheY
Organism
lus  Luteimonas yindakuii
Pathway
lus02020  Two-component system
lus02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:lus00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    E5843_12900
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    E5843_12900
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:lus02022]
    E5843_12900
   02035 Bacterial motility proteins [BR:lus02035]
    E5843_12900
Two-component system [BR:lus02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   E5843_12900
Bacterial motility proteins [BR:lus02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    E5843_12900
SSDB
Motif
Pfam: Response_reg
Other DBs
NCBI-ProteinID: QCO68437
LinkDB
Position
2659045..2659413
AA seq 122 aa
MSGRPTVLLCDDSRALRMLAAGQLDEAGFDVAGEAGNGLEAIRQYEALRPDLVLLDLVMP
ECDGREALARILELDPQARVVILSSLGAQRDIEECLRIGARSYLQKPIDTDAMERVLREA
LA
NT seq 369 nt   +upstreamnt  +downstreamnt
atgagcggacgaccgaccgtgctgttgtgcgacgactcgcgcgcgctgcgcatgctcgcg
gcagggcagctggacgaagccggcttcgacgtggcgggcgaggccggcaacggcctggag
gcgatccgccagtacgaggccctgcggccggacctggtgctgctggacctggtgatgccc
gaatgcgacgggcgcgaggcgctggcgcgcatcctcgaactcgacccgcaggcgcgggtg
gtgatcctcagctcgctgggcgcgcagcgcgacatcgaggagtgcctgcgcatcggcgcg
cgctcctacctgcagaagcccatcgacaccgacgcgatggagcgcgtgctgcgcgaggcg
ctcgcctga

DBGET integrated database retrieval system