Lutibacter profundi: Lupro_04515 Help Entry Lupro_04515       CDS       T04235                                  Name (GenBank) ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism lut  Lutibacter profundi Pathway lut00020   Citrate cycle (TCA cycle) lut00720   Other carbon fixation pathways lut01100   Metabolic pathways lut01110   Biosynthesis of secondary metabolites lut01120   Microbial metabolism in diverse environments lut01200   Carbon metabolism lut01210   2-Oxocarboxylic acid metabolism Module lut_M00009   Citrate cycle (TCA cycle, Krebs cycle) lut_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate Brite KEGG Orthology (KO) [BR:lut00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     Lupro_04515   09102 Energy metabolism    00720 Other carbon fixation pathways     Lupro_04515 Enzymes [BR:lut01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      Lupro_04515 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_21 Fer4_10 Fer4_6 Fer4_2 Fer4_16 LdpA_Fe-S-bd Fer4_9 Fer4_4 Fer4_22 Fer4_15 Fer4_17 Fer4_13 Fer4_8 Fer4_3 Motif Other DBs NCBI-ProteinID:  AMC10548 UniProt:  A0A0X8G5T0 LinkDB All DBs Position 1027883..1028113 Genome browser AA seq 76 aa AA seqDB search MAKVKGAIVVDTETCKGCEVCIPVCPENVISMSTEVNRKGYHYAYMSNPEVCTGCTNCGI VCPDRAISVYRVKVSA NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggcaaaagttaaaggtgcaattgtagttgatactgaaacttgtaaaggttgtgaagtt tgtatacctgtttgtcctgaaaacgtgataagtatgtctacagaagttaacagaaaaggt tatcattatgcctatatgagcaaccctgaagtttgtactgggtgtacaaattgtggtata gtttgtcctgatagggcaatatcagtatacagagttaaagtatctgcataa

DBGET integrated database retrieval system