KEGG   Lipotes vexillifer (Yangtze River dolphin): 103070260
Entry
103070260         CDS       T03090                                 
Symbol
MAPK1
Name
(RefSeq) mitogen-activated protein kinase 1 isoform X1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve01521  EGFR tyrosine kinase inhibitor resistance
lve01522  Endocrine resistance
lve01524  Platinum drug resistance
lve04010  MAPK signaling pathway
lve04012  ErbB signaling pathway
lve04014  Ras signaling pathway
lve04015  Rap1 signaling pathway
lve04022  cGMP-PKG signaling pathway
lve04024  cAMP signaling pathway
lve04062  Chemokine signaling pathway
lve04066  HIF-1 signaling pathway
lve04068  FoxO signaling pathway
lve04071  Sphingolipid signaling pathway
lve04072  Phospholipase D signaling pathway
lve04114  Oocyte meiosis
lve04140  Autophagy - animal
lve04148  Efferocytosis
lve04150  mTOR signaling pathway
lve04151  PI3K-Akt signaling pathway
lve04210  Apoptosis
lve04218  Cellular senescence
lve04261  Adrenergic signaling in cardiomyocytes
lve04270  Vascular smooth muscle contraction
lve04350  TGF-beta signaling pathway
lve04360  Axon guidance
lve04370  VEGF signaling pathway
lve04371  Apelin signaling pathway
lve04380  Osteoclast differentiation
lve04510  Focal adhesion
lve04517  IgSF CAM signaling
lve04520  Adherens junction
lve04540  Gap junction
lve04550  Signaling pathways regulating pluripotency of stem cells
lve04611  Platelet activation
lve04613  Neutrophil extracellular trap formation
lve04620  Toll-like receptor signaling pathway
lve04621  NOD-like receptor signaling pathway
lve04625  C-type lectin receptor signaling pathway
lve04650  Natural killer cell mediated cytotoxicity
lve04657  IL-17 signaling pathway
lve04658  Th1 and Th2 cell differentiation
lve04659  Th17 cell differentiation
lve04660  T cell receptor signaling pathway
lve04662  B cell receptor signaling pathway
lve04664  Fc epsilon RI signaling pathway
lve04666  Fc gamma R-mediated phagocytosis
lve04668  TNF signaling pathway
lve04713  Circadian entrainment
lve04720  Long-term potentiation
lve04722  Neurotrophin signaling pathway
lve04723  Retrograde endocannabinoid signaling
lve04724  Glutamatergic synapse
lve04725  Cholinergic synapse
lve04726  Serotonergic synapse
lve04730  Long-term depression
lve04810  Regulation of actin cytoskeleton
lve04910  Insulin signaling pathway
lve04912  GnRH signaling pathway
lve04914  Progesterone-mediated oocyte maturation
lve04915  Estrogen signaling pathway
lve04916  Melanogenesis
lve04917  Prolactin signaling pathway
lve04919  Thyroid hormone signaling pathway
lve04921  Oxytocin signaling pathway
lve04926  Relaxin signaling pathway
lve04928  Parathyroid hormone synthesis, secretion and action
lve04929  GnRH secretion
lve04930  Type II diabetes mellitus
lve04933  AGE-RAGE signaling pathway in diabetic complications
lve04934  Cushing syndrome
lve04935  Growth hormone synthesis, secretion and action
lve04960  Aldosterone-regulated sodium reabsorption
lve05010  Alzheimer disease
lve05020  Prion disease
lve05022  Pathways of neurodegeneration - multiple diseases
lve05034  Alcoholism
lve05132  Salmonella infection
lve05133  Pertussis
lve05135  Yersinia infection
lve05140  Leishmaniasis
lve05142  Chagas disease
lve05145  Toxoplasmosis
lve05152  Tuberculosis
lve05160  Hepatitis C
lve05161  Hepatitis B
lve05163  Human cytomegalovirus infection
lve05164  Influenza A
lve05165  Human papillomavirus infection
lve05166  Human T-cell leukemia virus 1 infection
lve05167  Kaposi sarcoma-associated herpesvirus infection
lve05170  Human immunodeficiency virus 1 infection
lve05171  Coronavirus disease - COVID-19
lve05200  Pathways in cancer
lve05203  Viral carcinogenesis
lve05205  Proteoglycans in cancer
lve05206  MicroRNAs in cancer
lve05207  Chemical carcinogenesis - receptor activation
lve05208  Chemical carcinogenesis - reactive oxygen species
lve05210  Colorectal cancer
lve05211  Renal cell carcinoma
lve05212  Pancreatic cancer
lve05213  Endometrial cancer
lve05214  Glioma
lve05215  Prostate cancer
lve05216  Thyroid cancer
lve05218  Melanoma
lve05219  Bladder cancer
lve05220  Chronic myeloid leukemia
lve05221  Acute myeloid leukemia
lve05223  Non-small cell lung cancer
lve05224  Breast cancer
lve05225  Hepatocellular carcinoma
lve05226  Gastric cancer
lve05230  Central carbon metabolism in cancer
lve05231  Choline metabolism in cancer
lve05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
lve05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103070260 (MAPK1)
   04012 ErbB signaling pathway
    103070260 (MAPK1)
   04014 Ras signaling pathway
    103070260 (MAPK1)
   04015 Rap1 signaling pathway
    103070260 (MAPK1)
   04350 TGF-beta signaling pathway
    103070260 (MAPK1)
   04370 VEGF signaling pathway
    103070260 (MAPK1)
   04371 Apelin signaling pathway
    103070260 (MAPK1)
   04668 TNF signaling pathway
    103070260 (MAPK1)
   04066 HIF-1 signaling pathway
    103070260 (MAPK1)
   04068 FoxO signaling pathway
    103070260 (MAPK1)
   04072 Phospholipase D signaling pathway
    103070260 (MAPK1)
   04071 Sphingolipid signaling pathway
    103070260 (MAPK1)
   04024 cAMP signaling pathway
    103070260 (MAPK1)
   04022 cGMP-PKG signaling pathway
    103070260 (MAPK1)
   04151 PI3K-Akt signaling pathway
    103070260 (MAPK1)
   04150 mTOR signaling pathway
    103070260 (MAPK1)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    103070260 (MAPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103070260 (MAPK1)
   04148 Efferocytosis
    103070260 (MAPK1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    103070260 (MAPK1)
   04210 Apoptosis
    103070260 (MAPK1)
   04218 Cellular senescence
    103070260 (MAPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103070260 (MAPK1)
   04520 Adherens junction
    103070260 (MAPK1)
   04540 Gap junction
    103070260 (MAPK1)
   04550 Signaling pathways regulating pluripotency of stem cells
    103070260 (MAPK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103070260 (MAPK1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103070260 (MAPK1)
   04613 Neutrophil extracellular trap formation
    103070260 (MAPK1)
   04620 Toll-like receptor signaling pathway
    103070260 (MAPK1)
   04621 NOD-like receptor signaling pathway
    103070260 (MAPK1)
   04625 C-type lectin receptor signaling pathway
    103070260 (MAPK1)
   04650 Natural killer cell mediated cytotoxicity
    103070260 (MAPK1)
   04660 T cell receptor signaling pathway
    103070260 (MAPK1)
   04658 Th1 and Th2 cell differentiation
    103070260 (MAPK1)
   04659 Th17 cell differentiation
    103070260 (MAPK1)
   04657 IL-17 signaling pathway
    103070260 (MAPK1)
   04662 B cell receptor signaling pathway
    103070260 (MAPK1)
   04664 Fc epsilon RI signaling pathway
    103070260 (MAPK1)
   04666 Fc gamma R-mediated phagocytosis
    103070260 (MAPK1)
   04062 Chemokine signaling pathway
    103070260 (MAPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103070260 (MAPK1)
   04929 GnRH secretion
    103070260 (MAPK1)
   04912 GnRH signaling pathway
    103070260 (MAPK1)
   04915 Estrogen signaling pathway
    103070260 (MAPK1)
   04914 Progesterone-mediated oocyte maturation
    103070260 (MAPK1)
   04917 Prolactin signaling pathway
    103070260 (MAPK1)
   04921 Oxytocin signaling pathway
    103070260 (MAPK1)
   04926 Relaxin signaling pathway
    103070260 (MAPK1)
   04935 Growth hormone synthesis, secretion and action
    103070260 (MAPK1)
   04919 Thyroid hormone signaling pathway
    103070260 (MAPK1)
   04928 Parathyroid hormone synthesis, secretion and action
    103070260 (MAPK1)
   04916 Melanogenesis
    103070260 (MAPK1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103070260 (MAPK1)
   04270 Vascular smooth muscle contraction
    103070260 (MAPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    103070260 (MAPK1)
  09156 Nervous system
   04724 Glutamatergic synapse
    103070260 (MAPK1)
   04725 Cholinergic synapse
    103070260 (MAPK1)
   04726 Serotonergic synapse
    103070260 (MAPK1)
   04720 Long-term potentiation
    103070260 (MAPK1)
   04730 Long-term depression
    103070260 (MAPK1)
   04723 Retrograde endocannabinoid signaling
    103070260 (MAPK1)
   04722 Neurotrophin signaling pathway
    103070260 (MAPK1)
  09158 Development and regeneration
   04360 Axon guidance
    103070260 (MAPK1)
   04380 Osteoclast differentiation
    103070260 (MAPK1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103070260 (MAPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103070260 (MAPK1)
   05206 MicroRNAs in cancer
    103070260 (MAPK1)
   05205 Proteoglycans in cancer
    103070260 (MAPK1)
   05207 Chemical carcinogenesis - receptor activation
    103070260 (MAPK1)
   05208 Chemical carcinogenesis - reactive oxygen species
    103070260 (MAPK1)
   05203 Viral carcinogenesis
    103070260 (MAPK1)
   05230 Central carbon metabolism in cancer
    103070260 (MAPK1)
   05231 Choline metabolism in cancer
    103070260 (MAPK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103070260 (MAPK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103070260 (MAPK1)
   05212 Pancreatic cancer
    103070260 (MAPK1)
   05225 Hepatocellular carcinoma
    103070260 (MAPK1)
   05226 Gastric cancer
    103070260 (MAPK1)
   05214 Glioma
    103070260 (MAPK1)
   05216 Thyroid cancer
    103070260 (MAPK1)
   05221 Acute myeloid leukemia
    103070260 (MAPK1)
   05220 Chronic myeloid leukemia
    103070260 (MAPK1)
   05218 Melanoma
    103070260 (MAPK1)
   05211 Renal cell carcinoma
    103070260 (MAPK1)
   05219 Bladder cancer
    103070260 (MAPK1)
   05215 Prostate cancer
    103070260 (MAPK1)
   05213 Endometrial cancer
    103070260 (MAPK1)
   05224 Breast cancer
    103070260 (MAPK1)
   05223 Non-small cell lung cancer
    103070260 (MAPK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103070260 (MAPK1)
   05170 Human immunodeficiency virus 1 infection
    103070260 (MAPK1)
   05161 Hepatitis B
    103070260 (MAPK1)
   05160 Hepatitis C
    103070260 (MAPK1)
   05171 Coronavirus disease - COVID-19
    103070260 (MAPK1)
   05164 Influenza A
    103070260 (MAPK1)
   05163 Human cytomegalovirus infection
    103070260 (MAPK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103070260 (MAPK1)
   05165 Human papillomavirus infection
    103070260 (MAPK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103070260 (MAPK1)
   05135 Yersinia infection
    103070260 (MAPK1)
   05133 Pertussis
    103070260 (MAPK1)
   05152 Tuberculosis
    103070260 (MAPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103070260 (MAPK1)
   05140 Leishmaniasis
    103070260 (MAPK1)
   05142 Chagas disease
    103070260 (MAPK1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103070260 (MAPK1)
   05020 Prion disease
    103070260 (MAPK1)
   05022 Pathways of neurodegeneration - multiple diseases
    103070260 (MAPK1)
  09165 Substance dependence
   05034 Alcoholism
    103070260 (MAPK1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    103070260 (MAPK1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    103070260 (MAPK1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103070260 (MAPK1)
   04934 Cushing syndrome
    103070260 (MAPK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103070260 (MAPK1)
   01524 Platinum drug resistance
    103070260 (MAPK1)
   01522 Endocrine resistance
    103070260 (MAPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lve01001]
    103070260 (MAPK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lve03036]
    103070260 (MAPK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lve04147]
    103070260 (MAPK1)
Enzymes [BR:lve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     103070260 (MAPK1)
Protein kinases [BR:lve01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   103070260 (MAPK1)
Chromosome and associated proteins [BR:lve03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     103070260 (MAPK1)
Exosome [BR:lve04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   103070260 (MAPK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase FTA2 Choline_kinase Kinase-like Kdo
Other DBs
NCBI-GeneID: 103070260
NCBI-ProteinID: XP_007451077
UniProt: A0A340WNH5
LinkDB
Position
Unknown
AA seq 263 aa
MKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLL
NTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCI
LAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNR
LFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDD
LPKEKLKELIFEETARFQPGYRS
NT seq 792 nt   +upstreamnt  +downstreamnt
atgaaagatgtatatatagtacaggacctcatggaaacagatctctacaagctcttgaag
acgcaacacctcagcaatgaccatatctgctattttctttaccagatcctcagagggtta
aaatatatccattcagctaacgtgctgcaccgtgacctcaaaccttccaacctgctgctc
aacaccacctgcgatctcaagatctgtgactttggcttggcccgtgttgcagatccagac
catgatcacacagggttcctgacggagtacgttgccacacgttggtacagggctccggaa
attatgttgaattccaagggctacaccaagtccattgatatttggtctgtaggctgcatc
ctggcagagatgctctccaacaggcccatcttcccggggaagcattacctcgaccagctg
aaccacattctgggtattcttggatccccatcccaggaagacctgaattgtataataaat
ttaaaagctagaaactatttgctttctcttccgcacaaaaataaggtgccatggaacagg
ctgttcccaaatgctgactccaaagctctagatttactggacaagatgttgacgttcaac
cctcataagaggattgaggtggaacaggctctggcccacccatacctggagcagtactac
gacccaagtgacgagcccatcgccgaagcaccgttcaagtttgacatggaattggatgac
ttgcccaaggaaaagctcaaagaactcatttttgaagagaccgctagattccagccagga
tacagatcttaa

DBGET integrated database retrieval system