KEGG   Lipotes vexillifer (Yangtze River dolphin): 103076043
Entry
103076043         CDS       T03090                                 
Symbol
HRAS
Name
(RefSeq) GTPase HRas isoform X1
  KO
K02833  GTPase HRas
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve01521  EGFR tyrosine kinase inhibitor resistance
lve01522  Endocrine resistance
lve04010  MAPK signaling pathway
lve04012  ErbB signaling pathway
lve04014  Ras signaling pathway
lve04015  Rap1 signaling pathway
lve04062  Chemokine signaling pathway
lve04068  FoxO signaling pathway
lve04071  Sphingolipid signaling pathway
lve04072  Phospholipase D signaling pathway
lve04137  Mitophagy - animal
lve04140  Autophagy - animal
lve04144  Endocytosis
lve04150  mTOR signaling pathway
lve04151  PI3K-Akt signaling pathway
lve04210  Apoptosis
lve04211  Longevity regulating pathway
lve04213  Longevity regulating pathway - multiple species
lve04218  Cellular senescence
lve04360  Axon guidance
lve04370  VEGF signaling pathway
lve04371  Apelin signaling pathway
lve04510  Focal adhesion
lve04519  Cadherin signaling
lve04540  Gap junction
lve04550  Signaling pathways regulating pluripotency of stem cells
lve04625  C-type lectin receptor signaling pathway
lve04630  JAK-STAT signaling pathway
lve04650  Natural killer cell mediated cytotoxicity
lve04660  T cell receptor signaling pathway
lve04662  B cell receptor signaling pathway
lve04664  Fc epsilon RI signaling pathway
lve04714  Thermogenesis
lve04720  Long-term potentiation
lve04722  Neurotrophin signaling pathway
lve04725  Cholinergic synapse
lve04726  Serotonergic synapse
lve04730  Long-term depression
lve04810  Regulation of actin cytoskeleton
lve04910  Insulin signaling pathway
lve04912  GnRH signaling pathway
lve04915  Estrogen signaling pathway
lve04916  Melanogenesis
lve04917  Prolactin signaling pathway
lve04919  Thyroid hormone signaling pathway
lve04921  Oxytocin signaling pathway
lve04926  Relaxin signaling pathway
lve04929  GnRH secretion
lve04933  AGE-RAGE signaling pathway in diabetic complications
lve04935  Growth hormone synthesis, secretion and action
lve05010  Alzheimer disease
lve05022  Pathways of neurodegeneration - multiple diseases
lve05034  Alcoholism
lve05132  Salmonella infection
lve05160  Hepatitis C
lve05161  Hepatitis B
lve05163  Human cytomegalovirus infection
lve05165  Human papillomavirus infection
lve05166  Human T-cell leukemia virus 1 infection
lve05167  Kaposi sarcoma-associated herpesvirus infection
lve05170  Human immunodeficiency virus 1 infection
lve05200  Pathways in cancer
lve05203  Viral carcinogenesis
lve05205  Proteoglycans in cancer
lve05206  MicroRNAs in cancer
lve05207  Chemical carcinogenesis - receptor activation
lve05208  Chemical carcinogenesis - reactive oxygen species
lve05210  Colorectal cancer
lve05211  Renal cell carcinoma
lve05213  Endometrial cancer
lve05214  Glioma
lve05215  Prostate cancer
lve05216  Thyroid cancer
lve05218  Melanoma
lve05219  Bladder cancer
lve05220  Chronic myeloid leukemia
lve05221  Acute myeloid leukemia
lve05223  Non-small cell lung cancer
lve05224  Breast cancer
lve05225  Hepatocellular carcinoma
lve05226  Gastric cancer
lve05230  Central carbon metabolism in cancer
lve05231  Choline metabolism in cancer
lve05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
lve05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103076043 (HRAS)
   04012 ErbB signaling pathway
    103076043 (HRAS)
   04014 Ras signaling pathway
    103076043 (HRAS)
   04015 Rap1 signaling pathway
    103076043 (HRAS)
   04370 VEGF signaling pathway
    103076043 (HRAS)
   04371 Apelin signaling pathway
    103076043 (HRAS)
   04630 JAK-STAT signaling pathway
    103076043 (HRAS)
   04068 FoxO signaling pathway
    103076043 (HRAS)
   04072 Phospholipase D signaling pathway
    103076043 (HRAS)
   04071 Sphingolipid signaling pathway
    103076043 (HRAS)
   04151 PI3K-Akt signaling pathway
    103076043 (HRAS)
   04150 mTOR signaling pathway
    103076043 (HRAS)
  09133 Signaling molecules and interaction
   04519 Cadherin signaling
    103076043 (HRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103076043 (HRAS)
   04140 Autophagy - animal
    103076043 (HRAS)
   04137 Mitophagy - animal
    103076043 (HRAS)
  09143 Cell growth and death
   04210 Apoptosis
    103076043 (HRAS)
   04218 Cellular senescence
    103076043 (HRAS)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103076043 (HRAS)
   04540 Gap junction
    103076043 (HRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    103076043 (HRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103076043 (HRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    103076043 (HRAS)
   04650 Natural killer cell mediated cytotoxicity
    103076043 (HRAS)
   04660 T cell receptor signaling pathway
    103076043 (HRAS)
   04662 B cell receptor signaling pathway
    103076043 (HRAS)
   04664 Fc epsilon RI signaling pathway
    103076043 (HRAS)
   04062 Chemokine signaling pathway
    103076043 (HRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103076043 (HRAS)
   04929 GnRH secretion
    103076043 (HRAS)
   04912 GnRH signaling pathway
    103076043 (HRAS)
   04915 Estrogen signaling pathway
    103076043 (HRAS)
   04917 Prolactin signaling pathway
    103076043 (HRAS)
   04921 Oxytocin signaling pathway
    103076043 (HRAS)
   04926 Relaxin signaling pathway
    103076043 (HRAS)
   04935 Growth hormone synthesis, secretion and action
    103076043 (HRAS)
   04919 Thyroid hormone signaling pathway
    103076043 (HRAS)
   04916 Melanogenesis
    103076043 (HRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    103076043 (HRAS)
   04726 Serotonergic synapse
    103076043 (HRAS)
   04720 Long-term potentiation
    103076043 (HRAS)
   04730 Long-term depression
    103076043 (HRAS)
   04722 Neurotrophin signaling pathway
    103076043 (HRAS)
  09158 Development and regeneration
   04360 Axon guidance
    103076043 (HRAS)
  09149 Aging
   04211 Longevity regulating pathway
    103076043 (HRAS)
   04213 Longevity regulating pathway - multiple species
    103076043 (HRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    103076043 (HRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103076043 (HRAS)
   05206 MicroRNAs in cancer
    103076043 (HRAS)
   05205 Proteoglycans in cancer
    103076043 (HRAS)
   05207 Chemical carcinogenesis - receptor activation
    103076043 (HRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    103076043 (HRAS)
   05203 Viral carcinogenesis
    103076043 (HRAS)
   05230 Central carbon metabolism in cancer
    103076043 (HRAS)
   05231 Choline metabolism in cancer
    103076043 (HRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103076043 (HRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103076043 (HRAS)
   05225 Hepatocellular carcinoma
    103076043 (HRAS)
   05226 Gastric cancer
    103076043 (HRAS)
   05214 Glioma
    103076043 (HRAS)
   05216 Thyroid cancer
    103076043 (HRAS)
   05221 Acute myeloid leukemia
    103076043 (HRAS)
   05220 Chronic myeloid leukemia
    103076043 (HRAS)
   05218 Melanoma
    103076043 (HRAS)
   05211 Renal cell carcinoma
    103076043 (HRAS)
   05219 Bladder cancer
    103076043 (HRAS)
   05215 Prostate cancer
    103076043 (HRAS)
   05213 Endometrial cancer
    103076043 (HRAS)
   05224 Breast cancer
    103076043 (HRAS)
   05223 Non-small cell lung cancer
    103076043 (HRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103076043 (HRAS)
   05170 Human immunodeficiency virus 1 infection
    103076043 (HRAS)
   05161 Hepatitis B
    103076043 (HRAS)
   05160 Hepatitis C
    103076043 (HRAS)
   05163 Human cytomegalovirus infection
    103076043 (HRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103076043 (HRAS)
   05165 Human papillomavirus infection
    103076043 (HRAS)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103076043 (HRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103076043 (HRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    103076043 (HRAS)
  09165 Substance dependence
   05034 Alcoholism
    103076043 (HRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    103076043 (HRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103076043 (HRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103076043 (HRAS)
   01522 Endocrine resistance
    103076043 (HRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lve04131]
    103076043 (HRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lve04147]
    103076043 (HRAS)
   04031 GTP-binding proteins [BR:lve04031]
    103076043 (HRAS)
Membrane trafficking [BR:lve04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    103076043 (HRAS)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    103076043 (HRAS)
Exosome [BR:lve04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103076043 (HRAS)
  Exosomal proteins of colorectal cancer cells
   103076043 (HRAS)
GTP-binding proteins [BR:lve04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    103076043 (HRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin AAA_22 Ldh_1_N DUF6974
Other DBs
NCBI-GeneID: 103076043
NCBI-ProteinID: XP_007465975
UniProt: A0A340Y3B4
LinkDB
Position
Unknown
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNAKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL
AARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKARKLSPPDEGGPG
CLSCRCLLS
NT seq 570 nt   +upstreamnt  +downstreamnt
atgacggagtataagctcgtggtggtgggcgctggaggggtagggaagagcgccctgacc
atccagctcatccagaaccactttgtggatgagtacgaccccaccatagaggactcctac
cggaagcaagtggtcatcgatggggagacgtgcctgctggacatcctggacacggcgggc
caggaggagtacagcgccatgcgggaccagtacatgcgcactggggagggcttcctttgt
gtgtttgccatcaacaatgccaagtccttcgaggacatccaccagtacagggagcagatc
aagcgggtgaaggactcggacgacgtgcccatggtgctggtggggaacaagtgtgacctg
gccgcgcgcaccgtggagtctcggcaggcccaggacctcgcccgcagctacggcatcccc
tacatcgagacttcggccaagacgcgccagggcgtggaggatgccttctacacgctggtg
cgcgagatccggcagcacaaggcgcgcaagctgagcccgcctgacgagggtggcccgggc
tgcctgagctgcaggtgcctgctctcctga

DBGET integrated database retrieval system