Entry |
|
Symbol |
HRAS
|
Name |
(RefSeq) GTPase HRas isoform X1
|
KO |
|
Organism |
lve Lipotes vexillifer (Yangtze River dolphin)
|
Pathway |
lve01521 | EGFR tyrosine kinase inhibitor resistance |
lve04072 | Phospholipase D signaling pathway |
lve04213 | Longevity regulating pathway - multiple species |
lve04550 | Signaling pathways regulating pluripotency of stem cells |
lve04625 | C-type lectin receptor signaling pathway |
lve04650 | Natural killer cell mediated cytotoxicity |
lve04660 | T cell receptor signaling pathway |
lve04662 | B cell receptor signaling pathway |
lve04664 | Fc epsilon RI signaling pathway |
lve04810 | Regulation of actin cytoskeleton |
lve04919 | Thyroid hormone signaling pathway |
lve04933 | AGE-RAGE signaling pathway in diabetic complications |
lve04935 | Growth hormone synthesis, secretion and action |
lve05022 | Pathways of neurodegeneration - multiple diseases |
lve05163 | Human cytomegalovirus infection |
lve05166 | Human T-cell leukemia virus 1 infection |
lve05167 | Kaposi sarcoma-associated herpesvirus infection |
lve05170 | Human immunodeficiency virus 1 infection |
lve05207 | Chemical carcinogenesis - receptor activation |
lve05208 | Chemical carcinogenesis - reactive oxygen species |
lve05230 | Central carbon metabolism in cancer |
lve05235 | PD-L1 expression and PD-1 checkpoint pathway in cancer |
|
Brite |
KEGG Orthology (KO) [BR:lve00001]
09130 Environmental Information Processing
09132 Signal transduction
04010 MAPK signaling pathway
103076043 (HRAS)
04012 ErbB signaling pathway
103076043 (HRAS)
04014 Ras signaling pathway
103076043 (HRAS)
04015 Rap1 signaling pathway
103076043 (HRAS)
04370 VEGF signaling pathway
103076043 (HRAS)
04371 Apelin signaling pathway
103076043 (HRAS)
04630 JAK-STAT signaling pathway
103076043 (HRAS)
04068 FoxO signaling pathway
103076043 (HRAS)
04072 Phospholipase D signaling pathway
103076043 (HRAS)
04071 Sphingolipid signaling pathway
103076043 (HRAS)
04151 PI3K-Akt signaling pathway
103076043 (HRAS)
04150 mTOR signaling pathway
103076043 (HRAS)
09140 Cellular Processes
09141 Transport and catabolism
04144 Endocytosis
103076043 (HRAS)
04140 Autophagy - animal
103076043 (HRAS)
04137 Mitophagy - animal
103076043 (HRAS)
09143 Cell growth and death
04210 Apoptosis
103076043 (HRAS)
04218 Cellular senescence
103076043 (HRAS)
09144 Cellular community - eukaryotes
04510 Focal adhesion
103076043 (HRAS)
04540 Gap junction
103076043 (HRAS)
04550 Signaling pathways regulating pluripotency of stem cells
103076043 (HRAS)
09142 Cell motility
04810 Regulation of actin cytoskeleton
103076043 (HRAS)
09150 Organismal Systems
09151 Immune system
04625 C-type lectin receptor signaling pathway
103076043 (HRAS)
04650 Natural killer cell mediated cytotoxicity
103076043 (HRAS)
04660 T cell receptor signaling pathway
103076043 (HRAS)
04662 B cell receptor signaling pathway
103076043 (HRAS)
04664 Fc epsilon RI signaling pathway
103076043 (HRAS)
04062 Chemokine signaling pathway
103076043 (HRAS)
09152 Endocrine system
04910 Insulin signaling pathway
103076043 (HRAS)
04929 GnRH secretion
103076043 (HRAS)
04912 GnRH signaling pathway
103076043 (HRAS)
04915 Estrogen signaling pathway
103076043 (HRAS)
04917 Prolactin signaling pathway
103076043 (HRAS)
04921 Oxytocin signaling pathway
103076043 (HRAS)
04926 Relaxin signaling pathway
103076043 (HRAS)
04935 Growth hormone synthesis, secretion and action
103076043 (HRAS)
04919 Thyroid hormone signaling pathway
103076043 (HRAS)
04916 Melanogenesis
103076043 (HRAS)
09156 Nervous system
04725 Cholinergic synapse
103076043 (HRAS)
04726 Serotonergic synapse
103076043 (HRAS)
04720 Long-term potentiation
103076043 (HRAS)
04730 Long-term depression
103076043 (HRAS)
04722 Neurotrophin signaling pathway
103076043 (HRAS)
09158 Development and regeneration
04360 Axon guidance
103076043 (HRAS)
09149 Aging
04211 Longevity regulating pathway
103076043 (HRAS)
04213 Longevity regulating pathway - multiple species
103076043 (HRAS)
09159 Environmental adaptation
04714 Thermogenesis
103076043 (HRAS)
09160 Human Diseases
09161 Cancer: overview
05200 Pathways in cancer
103076043 (HRAS)
05206 MicroRNAs in cancer
103076043 (HRAS)
05205 Proteoglycans in cancer
103076043 (HRAS)
05207 Chemical carcinogenesis - receptor activation
103076043 (HRAS)
05208 Chemical carcinogenesis - reactive oxygen species
103076043 (HRAS)
05203 Viral carcinogenesis
103076043 (HRAS)
05230 Central carbon metabolism in cancer
103076043 (HRAS)
05231 Choline metabolism in cancer
103076043 (HRAS)
05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
103076043 (HRAS)
09162 Cancer: specific types
05210 Colorectal cancer
103076043 (HRAS)
05225 Hepatocellular carcinoma
103076043 (HRAS)
05226 Gastric cancer
103076043 (HRAS)
05214 Glioma
103076043 (HRAS)
05216 Thyroid cancer
103076043 (HRAS)
05221 Acute myeloid leukemia
103076043 (HRAS)
05220 Chronic myeloid leukemia
103076043 (HRAS)
05218 Melanoma
103076043 (HRAS)
05211 Renal cell carcinoma
103076043 (HRAS)
05219 Bladder cancer
103076043 (HRAS)
05215 Prostate cancer
103076043 (HRAS)
05213 Endometrial cancer
103076043 (HRAS)
05224 Breast cancer
103076043 (HRAS)
05223 Non-small cell lung cancer
103076043 (HRAS)
09172 Infectious disease: viral
05166 Human T-cell leukemia virus 1 infection
103076043 (HRAS)
05170 Human immunodeficiency virus 1 infection
103076043 (HRAS)
05161 Hepatitis B
103076043 (HRAS)
05160 Hepatitis C
103076043 (HRAS)
05163 Human cytomegalovirus infection
103076043 (HRAS)
05167 Kaposi sarcoma-associated herpesvirus infection
103076043 (HRAS)
05165 Human papillomavirus infection
103076043 (HRAS)
09171 Infectious disease: bacterial
05132 Salmonella infection
103076043 (HRAS)
09164 Neurodegenerative disease
05010 Alzheimer disease
103076043 (HRAS)
05022 Pathways of neurodegeneration - multiple diseases
103076043 (HRAS)
09165 Substance dependence
05034 Alcoholism
103076043 (HRAS)
09166 Cardiovascular disease
05417 Lipid and atherosclerosis
103076043 (HRAS)
09167 Endocrine and metabolic disease
04933 AGE-RAGE signaling pathway in diabetic complications
103076043 (HRAS)
09176 Drug resistance: antineoplastic
01521 EGFR tyrosine kinase inhibitor resistance
103076043 (HRAS)
01522 Endocrine resistance
103076043 (HRAS)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:lve04131]
103076043 (HRAS)
09183 Protein families: signaling and cellular processes
04147 Exosome [BR:lve04147]
103076043 (HRAS)
04031 GTP-binding proteins [BR:lve04031]
103076043 (HRAS)
Membrane trafficking [BR:lve04131]
Exocytosis
Small GTPases and associated proteins
Other small GTPases and associated proteins
103076043 (HRAS)
Endocytosis
Macropinocytosis
Ras GTPases
103076043 (HRAS)
Exosome [BR:lve04147]
Exosomal proteins
Exosomal proteins of other body fluids (saliva and urine)
103076043 (HRAS)
Exosomal proteins of colorectal cancer cells
103076043 (HRAS)
GTP-binding proteins [BR:lve04031]
Small (monomeric) G-proteins
Ras Family
Ras [OT]
103076043 (HRAS)
|
SSDB |
|
Motif |
|
Other DBs |
|
LinkDB |
|
Position |
Unknown
|
AA seq |
189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNAKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL
AARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKARKLSPPDEGGPG
CLSCRCLLS |
NT seq |
570 nt +upstreamnt +downstreamnt
atgacggagtataagctcgtggtggtgggcgctggaggggtagggaagagcgccctgacc
atccagctcatccagaaccactttgtggatgagtacgaccccaccatagaggactcctac
cggaagcaagtggtcatcgatggggagacgtgcctgctggacatcctggacacggcgggc
caggaggagtacagcgccatgcgggaccagtacatgcgcactggggagggcttcctttgt
gtgtttgccatcaacaatgccaagtccttcgaggacatccaccagtacagggagcagatc
aagcgggtgaaggactcggacgacgtgcccatggtgctggtggggaacaagtgtgacctg
gccgcgcgcaccgtggagtctcggcaggcccaggacctcgcccgcagctacggcatcccc
tacatcgagacttcggccaagacgcgccagggcgtggaggatgccttctacacgctggtg
cgcgagatccggcagcacaaggcgcgcaagctgagcccgcctgacgagggtggcccgggc
tgcctgagctgcaggtgcctgctctcctga |