Leucobacter viscericola: G7068_10060 Help Entry G7068_10060       CDS       T07181                                  Name (GenBank) integration host factor   KO K03530   DNA-binding protein HU-beta Organism lvi  Leucobacter viscericola Brite KEGG Orthology (KO) [BR:lvi00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:lvi03032]     G7068_10060    03036 Chromosome and associated proteins [BR:lvi03036]     G7068_10060    03400 DNA repair and recombination proteins [BR:lvi03400]     G7068_10060 DNA replication proteins [BR:lvi03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     G7068_10060 Chromosome and associated proteins [BR:lvi03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     G7068_10060 DNA repair and recombination proteins [BR:lvi03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       G7068_10060 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_2 Motif Other DBs NCBI-ProteinID:  QIK63505 UniProt:  A0A6G7XG17 LinkDB All DBs Position 2294236..2294514 Genome browser AA seq 92 aa AA seqDB search MALNKTELVAKIAAETGQSQAAVSSVLDGLFAAVSETVAGGEKVSIPGWISFETATTAAR TGRNPRTGESIDIPAGKRVKVSVGSKLKAAVK NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atggcactcaacaagactgagctcgtagcaaagatcgccgcagaaaccggccagagccag gctgctgtttcgagcgttctcgacggcctgttcgccgctgtttccgagactgtcgccggt ggcgagaaggtctccatcccgggctggatctccttcgagaccgcaaccaccgctgctcgc accggccgcaacccgcgcaccggcgagagcatcgacatccccgctggcaagcgcgtcaag gtgtcggttggcagcaagctcaaggcagctgttaagtaa

DBGET integrated database retrieval system