KEGG   Leucobacter viscericola: G7068_14245
Entry
G7068_14245       CDS       T07181                                 
Symbol
rplR
Name
(GenBank) 50S ribosomal protein L18
  KO
K02881  large subunit ribosomal protein L18
Organism
lvi  Leucobacter viscericola
Pathway
lvi03010  Ribosome
Brite
KEGG Orthology (KO) [BR:lvi00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    G7068_14245 (rplR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:lvi03011]
    G7068_14245 (rplR)
Ribosome [BR:lvi03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    G7068_14245 (rplR)
  Bacteria
    G7068_14245 (rplR)
  Archaea
    G7068_14245 (rplR)
SSDB
Motif
Pfam: Ribosomal_L18p DUF6778
Other DBs
NCBI-ProteinID: QIK64231
UniProt: A0A6G7XIN4
LinkDB
Position
3263140..3263514
AA seq 124 aa
MAASISRAKGRSAARVRRHARLRKKIVGTEVRPRLAVTRSARHIFVQVIDDSKGFTLASA
STMEADLRSFEGDKTAKARKVGEIVAERAKSAGIDAVVFDRGGSKYAGRVAAIAEGAREG
GLTL
NT seq 375 nt   +upstreamnt  +downstreamnt
atggccgcttcaatttctcgggctaagggacgttcggctgcgcgtgttcgccgccacgcc
cgtctccgcaagaagatcgtcggcacggaggttcgcccccgtctcgccgtgacccgctcc
gcgcgtcacatcttcgttcaggtcatcgacgattccaagggcttcaccctggcatcggct
tcgaccatggaagctgatctgcgctctttcgagggcgacaagacggcaaaggcacgcaag
gttggcgagatcgtcgccgagcgcgcaaagagtgctggcatcgatgctgtggtctttgac
cgcggcggcagcaagtacgcaggtcgggtcgctgcgatcgccgaaggcgctcgcgaaggg
ggtctgaccctgtga

DBGET integrated database retrieval system