Limimaricola variabilis: T8T21_05210 Help Entry T8T21_05210       CDS       T09625                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism lvr  Limimaricola variabilis Pathway lvr01100   Metabolic pathways lvr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:lvr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     T8T21_05210    00074 Mycolic acid biosynthesis     T8T21_05210   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     T8T21_05210 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  WPY95523 LinkDB All DBs Position complement(1064102..1064368) Genome browser AA seq 88 aa AA seqDB search MDLREKVIAIIADQAMLEPADVTPEQSPADLGIDSLGLVESIFAIEEAFDISVPFNANAP EESGFDISSVGAIVAAVERLVQDRHAAA NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atggatttgcgtgaaaaggtgattgccatcatcgccgatcaggcgatgctcgagccggcg gacgtgacgccggagcagagcccggccgatctcggaatcgacagtctcggtctcgtcgag agcatcttcgcgatcgaggaggcgttcgacatctcggtgccgttcaacgccaacgccccc gaggagagcggcttcgacatctcctcggtcggggcgatcgtcgccgcggtcgagcggctg gtccaggaccggcacgccgccgcatga

DBGET integrated database retrieval system