KEGG   Yoonia vestfoldensis: LOKVESSMR4R_03014
Entry
LOKVESSMR4R_03014 CDS       T04854                                 
Symbol
potA
Name
(GenBank) spermidine/putrescine import ATP-binding protein PotA
  KO
K02052  putative spermidine/putrescine transport system ATP-binding protein
Organism
lvs  Yoonia vestfoldensis
Pathway
lvs02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:lvs00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    LOKVESSMR4R_03014 (potA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lvs02000]
    LOKVESSMR4R_03014 (potA)
Transporters [BR:lvs02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Putative spermidine/putrescine transporter
    LOKVESSMR4R_03014 (potA)
SSDB
Motif
Pfam: ABC_tran TOBE_2 SMC_N AAA_21 ABC_ATPase AAA_23 AAA AAA_22 AAA_25 CysA_C_terminal ORC-CDC6-like RsgA_GTPase AAA_29 AAA_28 NACHT DUF7784 Rad17 AAA_15 AAA_16 AAA_5 AAA_14 ATPase_2 nSTAND1 nSTAND3
Other DBs
NCBI-ProteinID: ARU02302
UniProt: A0A1Y0EG96
LinkDB
Position
complement(2983332..2984387)
AA seq 351 aa
MSGLSLKYIRKSYGDVRAVDNVSLDFAEGALTALLGPSGCGKTTLLRMIAGLEDPSAGTI
SLGGRDITGLPAHKRKFGMVFQSFALFPHLNVSDNVSYALTIAGTPRGQAAARARVLLDL
VQLSAFAERRIGELSGGQRQRVAIARALAQEPDVFLLDEPMSALDAKLREDMQVELRQLQ
QRLGITTIVVTHDQHEAMTMADQIVVMSQGRVEQVGTPQAIYHQPENAFVADFIGKANFF
DGVTEGGNVRLGGYLLQITPHANFIDGSHVRIAIRPEKAGLAGEVNRLPAKVTFLRDVGP
VRDIHLDTPIGPMIVTDSDSGQPLRVGDTVTVSVPAEAIHVFPRVAGQAAA
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgtccggcctgagcctgaaatatatccgcaaatcctatggcgatgtcagggctgtcgat
aatgtcagccttgattttgccgaaggcgcgctgacggcccttctggggccgtcgggttgc
ggcaagaccacgctcttgcgcatgatcgccgggctggaagaccccagcgcgggcacgatt
tcgttgggcgggcgggatatcaccggcctgcccgcgcataagcgcaaattcggcatggtg
tttcagtctttcgcattgttcccgcatctcaacgtcagcgataatgtcagctatgcgctg
accatcgcgggcacgccgcgcgggcaggcggcggcacgcgcgcgcgtcttgctggacctt
gtgcaattatccgcctttgccgagcggcggatcggggaattgtcgggcgggcaacgccag
cgcgtcgccatcgcacgcgccttggcgcaggaacccgatgtgttcttgctggatgaaccg
atgtccgcgctggatgccaaactgcgcgaggatatgcaggtcgaattgcgccagttgcag
cagcgtctgggcatcaccaccatcgtcgtcacccatgaccagcacgaagcgatgaccatg
gccgaccagatcgtcgtcatgtcgcagggccgcgtcgaacaggtcggcacgccacaggcg
atctatcaccagcccgaaaacgcctttgtcgcggatttcatcggcaaggcgaatttcttt
gacggcgtgaccgagggcggcaatgtccggctgggcgggtatctgctacagatcacgccg
catgccaatttcatcgacggatctcacgtgcgcattgcgatccgccccgaaaaggcaggt
ctggcgggcgaggtgaaccgtctgcctgccaaagtgacctttctgcgcgatgtggggccg
gtgcgcgacatccatctggatacgcccatcgggccgatgatcgtcaccgatagtgacagc
ggccagcctttgcgggtgggcgataccgtcacggtctctgtgccggcagaggcgatccac
gtctttccgcgcgtcgcgggtcaggccgccgcatga

DBGET integrated database retrieval system