Yoonia vestfoldensis: LOKVESSMR4R_03014
Help
Entry
LOKVESSMR4R_03014 CDS
T04854
Symbol
potA
Name
(GenBank) spermidine/putrescine import ATP-binding protein PotA
KO
K02052
putative spermidine/putrescine transport system ATP-binding protein
Organism
lvs
Yoonia vestfoldensis
Pathway
lvs02024
Quorum sensing
Brite
KEGG Orthology (KO) [BR:
lvs00001
]
09140 Cellular Processes
09145 Cellular community - prokaryotes
02024 Quorum sensing
LOKVESSMR4R_03014 (potA)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
lvs02000
]
LOKVESSMR4R_03014 (potA)
Transporters [BR:
lvs02000
]
ABC transporters, prokaryotic type
Mineral and organic ion transporters
Putative spermidine/putrescine transporter
LOKVESSMR4R_03014 (potA)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ABC_tran
TOBE_2
SMC_N
AAA_21
ABC_ATPase
AAA_23
AAA
AAA_22
AAA_25
CysA_C_terminal
ORC-CDC6-like
RsgA_GTPase
AAA_29
AAA_28
NACHT
DUF7784
Rad17
AAA_15
AAA_16
AAA_5
AAA_14
ATPase_2
nSTAND1
nSTAND3
Motif
Other DBs
NCBI-ProteinID:
ARU02302
UniProt:
A0A1Y0EG96
LinkDB
All DBs
Position
complement(2983332..2984387)
Genome browser
AA seq
351 aa
AA seq
DB search
MSGLSLKYIRKSYGDVRAVDNVSLDFAEGALTALLGPSGCGKTTLLRMIAGLEDPSAGTI
SLGGRDITGLPAHKRKFGMVFQSFALFPHLNVSDNVSYALTIAGTPRGQAAARARVLLDL
VQLSAFAERRIGELSGGQRQRVAIARALAQEPDVFLLDEPMSALDAKLREDMQVELRQLQ
QRLGITTIVVTHDQHEAMTMADQIVVMSQGRVEQVGTPQAIYHQPENAFVADFIGKANFF
DGVTEGGNVRLGGYLLQITPHANFIDGSHVRIAIRPEKAGLAGEVNRLPAKVTFLRDVGP
VRDIHLDTPIGPMIVTDSDSGQPLRVGDTVTVSVPAEAIHVFPRVAGQAAA
NT seq
1056 nt
NT seq
+upstream
nt +downstream
nt
atgtccggcctgagcctgaaatatatccgcaaatcctatggcgatgtcagggctgtcgat
aatgtcagccttgattttgccgaaggcgcgctgacggcccttctggggccgtcgggttgc
ggcaagaccacgctcttgcgcatgatcgccgggctggaagaccccagcgcgggcacgatt
tcgttgggcgggcgggatatcaccggcctgcccgcgcataagcgcaaattcggcatggtg
tttcagtctttcgcattgttcccgcatctcaacgtcagcgataatgtcagctatgcgctg
accatcgcgggcacgccgcgcgggcaggcggcggcacgcgcgcgcgtcttgctggacctt
gtgcaattatccgcctttgccgagcggcggatcggggaattgtcgggcgggcaacgccag
cgcgtcgccatcgcacgcgccttggcgcaggaacccgatgtgttcttgctggatgaaccg
atgtccgcgctggatgccaaactgcgcgaggatatgcaggtcgaattgcgccagttgcag
cagcgtctgggcatcaccaccatcgtcgtcacccatgaccagcacgaagcgatgaccatg
gccgaccagatcgtcgtcatgtcgcagggccgcgtcgaacaggtcggcacgccacaggcg
atctatcaccagcccgaaaacgcctttgtcgcggatttcatcggcaaggcgaatttcttt
gacggcgtgaccgagggcggcaatgtccggctgggcgggtatctgctacagatcacgccg
catgccaatttcatcgacggatctcacgtgcgcattgcgatccgccccgaaaaggcaggt
ctggcgggcgaggtgaaccgtctgcctgccaaagtgacctttctgcgcgatgtggggccg
gtgcgcgacatccatctggatacgcccatcgggccgatgatcgtcaccgatagtgacagc
ggccagcctttgcgggtgggcgataccgtcacggtctctgtgccggcagaggcgatccac
gtctttccgcgcgtcgcgggtcaggccgccgcatga
DBGET
integrated database retrieval system