Leptotrichia wadei: JCM16777_1118 Help Entry JCM16777_1118     CDS       T06741                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism lwd  Leptotrichia wadei Pathway lwd01100   Metabolic pathways lwd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:lwd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     JCM16777_1118 (acpP)    00074 Mycolic acid biosynthesis     JCM16777_1118 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     JCM16777_1118 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 DUF3970 DUF1493 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  BBM42868 LinkDB All DBs Position complement(1167124..1167348) Genome browser AA seq 74 aa AA seqDB search MLDKIKSIVVDQLGVDEDQVTEDASFVDDLGADSLDTVELIMAFEEEFDIEIPDEDAQKI KTVKDVMEYIEAKQ NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgctagataaaattaaatcaatagttgtagatcaattaggtgtagatgaagatcaagta actgaagatgcatcttttgttgatgatttaggagctgattcattggatacagttgaatta attatggcttttgaagaagaatttgatattgaaattcctgatgaagatgcacaaaaaatt aaaactgttaaagatgtaatggaatatattgaagctaaacaatag

DBGET integrated database retrieval system