Leptospira weilii: FHG68_05610 Help Entry FHG68_05610       CDS       T06081                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism lwl  Leptospira weilii Pathway lwl01100   Metabolic pathways lwl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:lwl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FHG68_05610 (acpP)    00074 Mycolic acid biosynthesis     FHG68_05610 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FHG68_05610 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  QDK26224 LinkDB All DBs Position I:1171507..1171740 Genome browser AA seq 77 aa AA seqDB search MADFEKVKSIIVEQLGVDESEVTPEAHFIDDLGADSLDTVELVMALEEEFGIEISDEDAE KIQTVGDVTKFIDNLKS NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggcagactttgaaaaagttaaatctattatcgtagaacaacttggagtggatgaatct gaagttacacctgaggctcacttcatcgacgacctcggtgcggactctctagatacggtt gaattagtgatggctcttgaagaagaattcggaatcgaaatctctgacgaagacgctgaa aaaattcaaactgtcggagacgtaactaagttcatcgacaacctcaagtcctaa

DBGET integrated database retrieval system