Leptonychotes weddellii (Weddell seal): 102726286 Help Entry 102726286         CDS       T08708                                  Name (RefSeq) histone H4-like   KO K11254   histone H4 Organism lww  Leptonychotes weddellii (Weddell seal) Pathway lww04613   Neutrophil extracellular trap formation lww05034   Alcoholism lww05203   Viral carcinogenesis lww05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:lww00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102726286  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     102726286   09163 Immune disease    05322 Systemic lupus erythematosus     102726286   09165 Substance dependence    05034 Alcoholism     102726286  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:lww03036]     102726286 Chromosome and associated proteins [BR:lww03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102726286 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP TFIID_20kDa Motif Other DBs NCBI-GeneID:  102726286 NCBI-ProteinID:  XP_006735987 UniProt:  A0A2U3XX00 LinkDB All DBs Position Unknown AA seq 78 aa AA seqDB search MYTSCIHERYSEEARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAM DVVYALKRQGRTLYGFGG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgtatacgtcctgtatacatgagagatactctgaagaagcccggcgcggcggcgtcaag cgcatctccggcctcatctacgaggagacccgcggggtgctcaaggtgttcctggagaac gtgatccgggacgccgtcacctacacggagcacgccaagcgcaagacggtcacggccatg gacgtggtctacgcgctcaagcgccagggccgcaccctctacggcttcgggggctaa

DBGET integrated database retrieval system