Leptonychotes weddellii (Weddell seal): 102726594 Help Entry 102726594         CDS       T08708                                  Name (RefSeq) histone H3.1-like   KO K11253   histone H3 Organism lww  Leptonychotes weddellii (Weddell seal) Pathway lww04613   Neutrophil extracellular trap formation lww05034   Alcoholism lww05202   Transcriptional misregulation in cancer lww05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:lww00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102726594  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     102726594   09163 Immune disease    05322 Systemic lupus erythematosus     102726594   09165 Substance dependence    05034 Alcoholism     102726594  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:lww03036]     102726594   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lww04147]     102726594 Chromosome and associated proteins [BR:lww03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102726594 Exosome [BR:lww04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102726594 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone PAF CENP-S CENP-T_C Motif Other DBs NCBI-GeneID:  102726594 NCBI-ProteinID:  XP_030886669 UniProt:  A0A7F8R006 LinkDB All DBs Position Unknown AA seq 144 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLQEACEAYLVGLFEDTNLCA IHAKRVTIMPKDIQLARRIRGERA NT seq 435 nt NT seq  +upstreamnt  +downstreamnt atggctcgcacgaagcagacggcccgcaagtcgaccggcggcaaggccccgcgcaagcag ctggccaccaaggcggcccgcaagagcgcgccggccaccggcggcgtcaagaagccgcac cgctaccggcccggcacggtggccctgcgcgagatccggcgctaccagaagtccaccgag ctgctgatccgcaagctgccnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn ctgcaggaggcgtgcgaggcctacctggtggggctcttcgaggacaccaacctgtgcgcc atccacgccaagcgcgtcaccatcatgcccaaggacatccagctggcgcgccgcatccgc ggggagagggcgtaa

DBGET integrated database retrieval system