Leptonychotes weddellii (Weddell seal): 102727550 Help Entry 102727550         CDS       T08708                                  Name (RefSeq) interferon alpha-1/2-like   KO K05414   interferon alpha Organism lww  Leptonychotes weddellii (Weddell seal) Pathway lww04060   Cytokine-cytokine receptor interaction lww04151   PI3K-Akt signaling pathway lww04217   Necroptosis lww04620   Toll-like receptor signaling pathway lww04621   NOD-like receptor signaling pathway lww04622   RIG-I-like receptor signaling pathway lww04623   Cytosolic DNA-sensing pathway lww04630   JAK-STAT signaling pathway lww04650   Natural killer cell mediated cytotoxicity lww04936   Alcoholic liver disease lww05152   Tuberculosis lww05160   Hepatitis C lww05161   Hepatitis B lww05162   Measles lww05163   Human cytomegalovirus infection lww05164   Influenza A lww05165   Human papillomavirus infection lww05167   Kaposi sarcoma-associated herpesvirus infection lww05168   Herpes simplex virus 1 infection lww05169   Epstein-Barr virus infection lww05170   Human immunodeficiency virus 1 infection lww05171   Coronavirus disease - COVID-19 lww05200   Pathways in cancer lww05320   Autoimmune thyroid disease lww05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:lww00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     102727550    04151 PI3K-Akt signaling pathway     102727550   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102727550  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     102727550  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102727550    04621 NOD-like receptor signaling pathway     102727550    04622 RIG-I-like receptor signaling pathway     102727550    04623 Cytosolic DNA-sensing pathway     102727550    04650 Natural killer cell mediated cytotoxicity     102727550  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102727550   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102727550    05161 Hepatitis B     102727550    05160 Hepatitis C     102727550    05171 Coronavirus disease - COVID-19     102727550    05164 Influenza A     102727550    05162 Measles     102727550    05168 Herpes simplex virus 1 infection     102727550    05163 Human cytomegalovirus infection     102727550    05167 Kaposi sarcoma-associated herpesvirus infection     102727550    05169 Epstein-Barr virus infection     102727550    05165 Human papillomavirus infection     102727550   09171 Infectious disease: bacterial    05152 Tuberculosis     102727550   09163 Immune disease    05320 Autoimmune thyroid disease     102727550   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102727550   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     102727550  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:lww04052]     102727550 Cytokines and neuropeptides [BR:lww04052]  Cytokines   Interferons    102727550 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  102727550 NCBI-ProteinID:  XP_006745532 UniProt:  A0A2U3YP80 LinkDB All DBs Position Unknown AA seq 187 aa AA seqDB search MALPFSFLVALVVLSCSSLCSLGCDLPQSHGLFAWRALTLLGQMRRISASSCNKYTSDFA FPQEVLDGKQLQKAQALSVVHVMNQKIFHLFCTEAPSAAWNETLLEEFCSGLSEQLTDLE ACPMQEAAGAETPLMKVDSILRNYFQRISLYLQEKQYSPCAWEIVRAEVTSSLFSSTILQ ERLRSKK NT seq 564 nt NT seq  +upstreamnt  +downstreamnt atggccctgcccttttccttcttggtggccctggtggtgctcagctgcagctccctctgc tctctgggatgtgacctgcctcagagccatggcctgttcgcctggagggccttgacgctc ctgggacaaatgaggagaatttctgctagctcttgtaacaagtacacaagtgactttgcc ttcccccaggaggtgcttgatggcaagcagttgcagaaggctcaagccctctctgtcgtc catgtgatgaaccagaagatcttccacctcttctgcacagaggccccatctgctgcttgg aacgagaccctcctagaggaattctgctcgggactttctgagcagctgaccgacctggaa gcctgtcccatgcaggaggcggcgggggcagagactcccctcatgaaggtggactccatc ctgaggaactacttccaaagaatctccctctatctgcaagagaagcaatacagcccttgt gcctgggagattgtcagagcagaagtcacgagctccttgttttcatcaacgatcttgcaa gaaagattaaggagcaagaaatga

DBGET integrated database retrieval system