Leptonychotes weddellii (Weddell seal): 102728766 Help Entry 102728766         CDS       T08708                                  Symbol PFN1 Name (RefSeq) profilin-1   KO K05759   profilin Organism lww  Leptonychotes weddellii (Weddell seal) Pathway lww04015   Rap1 signaling pathway lww04810   Regulation of actin cytoskeleton lww05014   Amyotrophic lateral sclerosis lww05132   Salmonella infection Brite KEGG Orthology (KO) [BR:lww00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     102728766 (PFN1)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     102728766 (PFN1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102728766 (PFN1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     102728766 (PFN1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lww04131]     102728766 (PFN1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:lww04812]     102728766 (PFN1)    04147 Exosome [BR:lww04147]     102728766 (PFN1) Membrane trafficking [BR:lww04131]  Others   Actin-binding proteins    Others     102728766 (PFN1) Cytoskeleton proteins [BR:lww04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      102728766 (PFN1) Exosome [BR:lww04147]  Exosomal proteins   Proteins found in most exosomes    102728766 (PFN1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  102728766 NCBI-ProteinID:  XP_030894825 UniProt:  A0A7F8RNC1 LinkDB All DBs Position Unknown AA seq 140 aa AA seqDB search MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKAFVNITPAEVGVLLGKDRSSFF VTGLTLGGQKCSVIRDSLLHDGDFTMDLRTKSTGGAPTFNITVTMSAKTLVLLMGKEGVH GGIINKKCYEMASHLRRSQY NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccgggtggaacgcctacatcgacaacctcatggcggacgggacctgtcaggacgcg gccatcgtgggctataaggactcgccctccgtctgggccgccgtccccgggaaagccttc gtcaacatcacgccagctgaggtcggtgtcctgcttggcaaagaccggtcaagttttttc gtgactgggctgacacttgggggccagaaatgttctgttatccgggactcactgctgcac gatggggactttaccatggatcttcgtaccaagagcaccgggggagcccccactttcaac atcactgtcaccatgagtgccaagacgctagtcctgctgatgggcaaagaaggtgtccac ggtggtataatcaacaagaaatgctatgaaatggcctcccacctgcggcgttcccagtac tga

DBGET integrated database retrieval system