Leptonychotes weddellii (Weddell seal): 102729432 Help Entry 102729432         CDS       T08708                                  Symbol YWHAG Name (RefSeq) 14-3-3 protein gamma   KO K16198   14-3-3 protein gamma/eta Organism lww  Leptonychotes weddellii (Weddell seal) Pathway lww04110   Cell cycle lww04114   Oocyte meiosis lww04151   PI3K-Akt signaling pathway lww04390   Hippo signaling pathway lww05160   Hepatitis C lww05203   Viral carcinogenesis Brite KEGG Orthology (KO) [BR:lww00001]  09130 Environmental Information Processing   09132 Signal transduction    04390 Hippo signaling pathway     102729432 (YWHAG)    04151 PI3K-Akt signaling pathway     102729432 (YWHAG)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     102729432 (YWHAG)    04114 Oocyte meiosis     102729432 (YWHAG)  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     102729432 (YWHAG)   09172 Infectious disease: viral    05160 Hepatitis C     102729432 (YWHAG)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:lww01009]     102729432 (YWHAG)   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:lww03400]     102729432 (YWHAG)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lww04147]     102729432 (YWHAG) Protein phosphatases and associated proteins [BR:lww01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      102729432 (YWHAG) DNA repair and recombination proteins [BR:lww03400]  Eukaryotic type   Check point factors    Other check point factors     102729432 (YWHAG) Exosome [BR:lww04147]  Exosomal proteins   Proteins found in most exosomes    102729432 (YWHAG) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  14-3-3 DUF7758 Motif Other DBs NCBI-GeneID:  102729432 NCBI-ProteinID:  XP_030884655 UniProt:  A0A7F8QU57 LinkDB All DBs Position Unknown AA seq 167 aa AA seqDB search MVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATG EKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTA FDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDDDGGEGNN NT seq 504 nt NT seq  +upstreamnt  +downstreamnt atggtccgtgcttaccgtgaaaaaatcgagaaggagctggaagcggtatgtcaggatgtg ctgagcctgctagataactacctgatcaagaattgcagtgagacccagtacgagagcaaa gtgttttacctgaagatgaaaggggactattatcgctacctggctgaagtcgccactgga gagaagagggcgaccgtcgtggagtcctctgagaaggcctatagcgaagcccacgagatc agcaaggagcacatgcagcctactcaccccattagattaggcctggctcttaactactcc gttttctactacgagatccagaatgccccagagcaagcctgccacttggccaagaccgcc ttcgatgacgccattgccgagctcgacactctgaacgaggactcctacaaggactccact ctcatcatgcagctcctccgcgacaacctaacgctctggacaagcgatcagcaagacgac gacggcggcgaaggcaacaattaa

DBGET integrated database retrieval system