Leptonychotes weddellii (Weddell seal): 102729517 Help Entry 102729517         CDS       T08708                                  Symbol CFL2 Name (RefSeq) cofilin-2   KO K05765   cofilin Organism lww  Leptonychotes weddellii (Weddell seal) Pathway lww04360   Axon guidance lww04666   Fc gamma R-mediated phagocytosis lww04810   Regulation of actin cytoskeleton lww05133   Pertussis lww05170   Human immunodeficiency virus 1 infection Brite KEGG Orthology (KO) [BR:lww00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     102729517 (CFL2)  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagocytosis     102729517 (CFL2)   09158 Development and regeneration    04360 Axon guidance     102729517 (CFL2)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102729517 (CFL2)   09171 Infectious disease: bacterial    05133 Pertussis     102729517 (CFL2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lww04131]     102729517 (CFL2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:lww04812]     102729517 (CFL2)    04147 Exosome [BR:lww04147]     102729517 (CFL2) Membrane trafficking [BR:lww04131]  Others   Actin-binding proteins    Others     102729517 (CFL2) Cytoskeleton proteins [BR:lww04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     ADF / Cofilin      102729517 (CFL2) Exosome [BR:lww04147]  Exosomal proteins   Proteins found in most exosomes    102729517 (CFL2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cofilin_ADF Motif Other DBs NCBI-GeneID:  102729517 NCBI-ProteinID:  XP_006732293 UniProt:  A0A2U3XLT5 LinkDB All DBs Position Unknown AA seq 166 aa AA seqDB search MASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDI GDTVEDPYTSFVKLLPLNDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASS KDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKLGGNVVVSLEGKPL NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atggcttctggagttacagtgaatgatgaagtcatcaaagtttttaatgatatgaaagta aggaaatcttctacacaagaggagatcaaaaaaagaaagaaagcagttctcttctgttta agcgatgacaaaagacaaataattgtagaggaagcaaagcagatcttggtgggtgacatt ggtgatactgtagaggacccctacacatcttttgtgaagttgctacctctgaatgattgc cgatatgctttgtacgatgccacatacgaaacaaaagagtctaagaaagaagacctagta tttatattctgggctcctgaaagtgcacctttaaaaagcaagatgatttatgctagctct aaagatgccattaaaaagaaatttacaggtattaaacatgagtggcaagtaaatggcttg gatgatataaaggaccgttcaacacttggagagaaattgggaggcaacgtagtagtttca cttgaaggaaaacccttataa

DBGET integrated database retrieval system