Leptonychotes weddellii (Weddell seal): 102730213 Help Entry 102730213         CDS       T08708                                  Name (RefSeq) histone H3.3   KO K11253   histone H3 Organism lww  Leptonychotes weddellii (Weddell seal) Pathway lww04613   Neutrophil extracellular trap formation lww05034   Alcoholism lww05202   Transcriptional misregulation in cancer lww05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:lww00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102730213  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     102730213   09163 Immune disease    05322 Systemic lupus erythematosus     102730213   09165 Substance dependence    05034 Alcoholism     102730213  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:lww03036]     102730213   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lww04147]     102730213 Chromosome and associated proteins [BR:lww03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102730213 Exosome [BR:lww04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102730213 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF TFIID-31kDa Motif Other DBs NCBI-GeneID:  102730213 NCBI-ProteinID:  XP_030877169 UniProt:  A0A2U3Z299 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgtacaaagcagactgcccgcaaatcgaccggtggtaaagcaccgaggaagcaa ctggctacaaaagccgctcgcaagagtgcgccctctactggaggggtgaagaaacctcat cgttacaggcctggtactgtggcactccgtgaaattagacgttaccagaagtccaccgaa cttctgatccgcaaacttcctttccagcgtctggtgcgagaaattgctcaggacttcaaa acagatctgcgcttccagagtgcagctattggtgctttgcaggaggcaagcgaggcctat ctggtgggcctctttgaagacaccaacctgtgtgctatccatgccaaacgtgtcacaatt atgccaaaagacatccagctagcgcgccgcatacgtggagaacgtgcttaa

DBGET integrated database retrieval system