Leptonychotes weddellii (Weddell seal): 102730558 Help Entry 102730558         CDS       T08708                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism lww  Leptonychotes weddellii (Weddell seal) Pathway lww04613   Neutrophil extracellular trap formation lww05034   Alcoholism lww05203   Viral carcinogenesis lww05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:lww00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102730558  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     102730558   09163 Immune disease    05322 Systemic lupus erythematosus     102730558   09165 Substance dependence    05034 Alcoholism     102730558  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:lww03036]     102730558 Chromosome and associated proteins [BR:lww03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102730558 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  102730558 NCBI-ProteinID:  XP_030886668 UniProt:  A0A2U3XX54 LinkDB All DBs Position Unknown AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtccggccgcggcaagggcgggaagggcctgggcaagggcggcgccaagcgccaccgc aaggtgctgcgcgacaacatccagggcatcaccaagcccgccatccggcggctggcccgg cgcggcggcgtcaagcgcatctccggcctcatctacgaggagacccgcggggtgctcaag gtgttcctggagaacgtgatccgggacgccgtcacctacacggagcacgccaagcgcaag acggtcacggccatggacgtggtctacgcgctcaagcgccagggccgcaccctctacggc ttcgggggctga

DBGET integrated database retrieval system