Leptonychotes weddellii (Weddell seal): 102731039 Help Entry 102731039         CDS       T08708                                  Name (RefSeq) histone H3.3-like   KO K11253   histone H3 Organism lww  Leptonychotes weddellii (Weddell seal) Pathway lww04613   Neutrophil extracellular trap formation lww05034   Alcoholism lww05202   Transcriptional misregulation in cancer lww05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:lww00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102731039  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     102731039   09163 Immune disease    05322 Systemic lupus erythematosus     102731039   09165 Substance dependence    05034 Alcoholism     102731039  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:lww03036]     102731039   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lww04147]     102731039 Chromosome and associated proteins [BR:lww03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102731039 Exosome [BR:lww04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102731039 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone PAF THSD1_D2 CENP-S Motif Other DBs NCBI-GeneID:  102731039 NCBI-ProteinID:  XP_006732297 UniProt:  A0A2U3XLF3 LinkDB All DBs Position Unknown AA seq 128 aa AA seqDB search MARTKPTARKRTRGKAPRKQLATKAARKSAPSTGGVKKPNRYRPGTVALREIRRYQKSTE LIRKLPFQHLVREIVQEFKTDLRFQSAAIGALQVGLFEDTNLCAIHAKRVTIMPKDIQLA RRIRGECA NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atggctcgtacaaagccgactgcccgcaaacggacccgtggtaaagcaccgaggaagcaa ctggctacaaaagccgctcgcaagagtgcgccctctactggaggggtgaagaaacctaat cgttacaggcctggtactgtggcactccgtgaaattagacgttatcagaagtccactgaa ctgatccgcaaacttcctttccagcatctggtgcgagaaattgttcaggaattcaaaaca gatctgcgcttccagagtgcagctattggtgctttgcaggtgggcctctttgaagacacc aacctgtgtgctatccatgccaaacgtgtcacaattatgccaaaagacatccagctagcg cgccgcatacgtggagaatgtgcttaa

DBGET integrated database retrieval system