Leptonychotes weddellii (Weddell seal): 102731169 Help Entry 102731169         CDS       T08708                                  Name (RefSeq) ubiquitin-like   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism lww  Leptonychotes weddellii (Weddell seal) Pathway lww03010   Ribosome lww04120   Ubiquitin mediated proteolysis lww04137   Mitophagy - animal lww04140   Autophagy - animal lww05012   Parkinson disease lww05022   Pathways of neurodegeneration - multiple diseases lww05167   Kaposi sarcoma-associated herpesvirus infection lww05171   Coronavirus disease - COVID-19 Brite KEGG Orthology (KO) [BR:lww00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     102731169   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     102731169  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102731169    04137 Mitophagy - animal     102731169  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     102731169    05167 Kaposi sarcoma-associated herpesvirus infection     102731169   09164 Neurodegenerative disease    05012 Parkinson disease     102731169    05022 Pathways of neurodegeneration - multiple diseases     102731169  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:lww03011]     102731169    04121 Ubiquitin system [BR:lww04121]     102731169 Ribosome [BR:lww03011]  Ribosomal proteins   Eukaryotes    Large subunit     102731169   Archaea     102731169 Ubiquitin system [BR:lww04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    102731169 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Ribosomal_L40e Rad60-SLD Ubiquitin_2 DZR_2 DUF2604 Rad60-SLD_2 TBK1_ULD Ubiquitin_5 OTU1_UBXL UBL_UBAC1 Motif Other DBs NCBI-GeneID:  102731169 NCBI-ProteinID:  XP_030887476 UniProt:  A0A7F8R2S8 LinkDB All DBs Position Unknown AA seq 126 aa AA seqDB search MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLVFAGKQLEDGRTLSDYN IQKESTLHLVLRLRGGIIEPSLRQLAQKYNCNKMICRKCYARLHPRTVNCCKKCGHTNNL HPKKVK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcagatctttgtgaagaccctgacgggcaagaccatcacccttgaggtcgagcccagt gacaccattgagaatgtcaaagccaaaatccaagacaaggagggcatcccgcctgaccag cagcgtctggtttttgcgggcaaacagctggaagatggccgtactctgtcagactataat atccagaaagagtccaccctgcacttggtgcttcgcctacggggtggcatcatcgagcct tccctccgccagctggcccagaaatacaactgcaacaagatgatctgccgcaagtgttat gctcgcctgcacccccgcactgtcaactgctgtaagaagtgcggccacaccaacaacctg caccccaaaaaggtcaaataa

DBGET integrated database retrieval system