Leptonychotes weddellii (Weddell seal): 102731595 Help Entry 102731595         CDS       T08708                                  Symbol RRAS Name (RefSeq) ras-related protein R-Ras   KO K07829   Ras-related protein R-Ras Organism lww  Leptonychotes weddellii (Weddell seal) Pathway lww04010   MAPK signaling pathway lww04014   Ras signaling pathway lww04015   Rap1 signaling pathway lww04024   cAMP signaling pathway lww04072   Phospholipase D signaling pathway lww04137   Mitophagy - animal lww04140   Autophagy - animal lww04218   Cellular senescence lww04360   Axon guidance lww04371   Apelin signaling pathway lww04625   C-type lectin receptor signaling pathway lww04810   Regulation of actin cytoskeleton lww05132   Salmonella infection lww05205   Proteoglycans in cancer Brite KEGG Orthology (KO) [BR:lww00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102731595 (RRAS)    04014 Ras signaling pathway     102731595 (RRAS)    04015 Rap1 signaling pathway     102731595 (RRAS)    04371 Apelin signaling pathway     102731595 (RRAS)    04072 Phospholipase D signaling pathway     102731595 (RRAS)    04024 cAMP signaling pathway     102731595 (RRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102731595 (RRAS)    04137 Mitophagy - animal     102731595 (RRAS)   09143 Cell growth and death    04218 Cellular senescence     102731595 (RRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     102731595 (RRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     102731595 (RRAS)   09158 Development and regeneration    04360 Axon guidance     102731595 (RRAS)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     102731595 (RRAS)   09171 Infectious disease: bacterial    05132 Salmonella infection     102731595 (RRAS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:lww04031]     102731595 (RRAS) GTP-binding proteins [BR:lww04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     102731595 (RRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 AAA_22 Abhydrolase_4 Motif Other DBs NCBI-GeneID:  102731595 NCBI-ProteinID:  XP_006744378 UniProt:  A0A2U3YLB4 LinkDB All DBs Position Unknown AA seq 218 aa AA seqDB search MSSGAASGTGRGRPRGGGPGPGDPPPSETHKLVVVGGGGVGKSALTIQFIQSYFVSDYDP TIEDSYTKICTVDGVPARLDILDTAGQEEFGAMREQYMRAGHGFLLVFAINDRQSFNEVG KLFTQILRVKDRDDFPIVLVGNKADLETQRQVPRSEASAFGASHHVAYFEASAKLRLNVD EAFEQLVRAVRKYQEQELPPSPPSAPRKKDGGCPCVLL NT seq 657 nt NT seq  +upstreamnt  +downstreamnt atgagcagcggggcggcgtccgggacagggcgggggcggccccggggcggggggccgggg cccggggaccccccacccagcgagacacacaagctggtggtcgtgggcggcggcggcgtg ggcaagagcgcgctgaccatccagttcatccagtcctactttgtgtctgactacgacccc accattgaagactcctatacgaagatctgcacggtggatggtgttccagcccggctggac atcctggacacagcaggccaggaggagttcggtgccatgcgggagcagtacatgcgcgct ggccacggtttcctgctggtgtttgccattaacgaccggcagagtttcaacgaggtgggc aagcttttcacgcagatcctccgagtcaaggaccgagacgatttccccatcgtgttggtt gggaacaaggcagatctggagacacagcgccaggtgccccgatctgaagcctctgccttt ggtgcctcccaccacgtggcctacttcgaggcctcagccaagttgcgtctcaacgtggac gaggccttcgagcagctggtgcgggccgtccggaagtatcaggaacaagagctcccgccc agcccacccagtgcccccaggaagaaagacggaggctgtccctgcgtcctcctgtag

DBGET integrated database retrieval system