Leptonychotes weddellii (Weddell seal): 102732630 Help Entry 102732630         CDS       T08708                                  Symbol PPP3R2 Name (RefSeq) calcineurin subunit B type 2   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism lww  Leptonychotes weddellii (Weddell seal) Pathway lww04010   MAPK signaling pathway lww04020   Calcium signaling pathway lww04022   cGMP-PKG signaling pathway lww04114   Oocyte meiosis lww04218   Cellular senescence lww04310   Wnt signaling pathway lww04360   Axon guidance lww04370   VEGF signaling pathway lww04380   Osteoclast differentiation lww04625   C-type lectin receptor signaling pathway lww04650   Natural killer cell mediated cytotoxicity lww04658   Th1 and Th2 cell differentiation lww04659   Th17 cell differentiation lww04660   T cell receptor signaling pathway lww04662   B cell receptor signaling pathway lww04720   Long-term potentiation lww04724   Glutamatergic synapse lww04921   Oxytocin signaling pathway lww04922   Glucagon signaling pathway lww04924   Renin secretion lww05010   Alzheimer disease lww05014   Amyotrophic lateral sclerosis lww05020   Prion disease lww05022   Pathways of neurodegeneration - multiple diseases lww05031   Amphetamine addiction lww05152   Tuberculosis lww05163   Human cytomegalovirus infection lww05166   Human T-cell leukemia virus 1 infection lww05167   Kaposi sarcoma-associated herpesvirus infection lww05170   Human immunodeficiency virus 1 infection lww05235   PD-L1 expression and PD-1 checkpoint pathway in cancer lww05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:lww00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102732630 (PPP3R2)    04310 Wnt signaling pathway     102732630 (PPP3R2)    04370 VEGF signaling pathway     102732630 (PPP3R2)    04020 Calcium signaling pathway     102732630 (PPP3R2)    04022 cGMP-PKG signaling pathway     102732630 (PPP3R2)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     102732630 (PPP3R2)    04218 Cellular senescence     102732630 (PPP3R2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     102732630 (PPP3R2)    04650 Natural killer cell mediated cytotoxicity     102732630 (PPP3R2)    04660 T cell receptor signaling pathway     102732630 (PPP3R2)    04658 Th1 and Th2 cell differentiation     102732630 (PPP3R2)    04659 Th17 cell differentiation     102732630 (PPP3R2)    04662 B cell receptor signaling pathway     102732630 (PPP3R2)   09152 Endocrine system    04922 Glucagon signaling pathway     102732630 (PPP3R2)    04921 Oxytocin signaling pathway     102732630 (PPP3R2)    04924 Renin secretion     102732630 (PPP3R2)   09156 Nervous system    04724 Glutamatergic synapse     102732630 (PPP3R2)    04720 Long-term potentiation     102732630 (PPP3R2)   09158 Development and regeneration    04360 Axon guidance     102732630 (PPP3R2)    04380 Osteoclast differentiation     102732630 (PPP3R2)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     102732630 (PPP3R2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102732630 (PPP3R2)    05170 Human immunodeficiency virus 1 infection     102732630 (PPP3R2)    05163 Human cytomegalovirus infection     102732630 (PPP3R2)    05167 Kaposi sarcoma-associated herpesvirus infection     102732630 (PPP3R2)   09171 Infectious disease: bacterial    05152 Tuberculosis     102732630 (PPP3R2)   09164 Neurodegenerative disease    05010 Alzheimer disease     102732630 (PPP3R2)    05014 Amyotrophic lateral sclerosis     102732630 (PPP3R2)    05020 Prion disease     102732630 (PPP3R2)    05022 Pathways of neurodegeneration - multiple diseases     102732630 (PPP3R2)   09165 Substance dependence    05031 Amphetamine addiction     102732630 (PPP3R2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102732630 (PPP3R2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:lww01009]     102732630 (PPP3R2) Protein phosphatases and associated proteins [BR:lww01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      102732630 (PPP3R2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EH EF-hand_9 flgK_1st_1 Motif Other DBs NCBI-GeneID:  102732630 NCBI-ProteinID:  XP_006727701 UniProt:  A0A2U3X8D3 LinkDB All DBs Position Unknown AA seq 170 aa AA seqDB search MGNEASYPEEICSRFNPDEIKRLGKRFKKLDLDCSGSLSVEEFMSVPELQQNPLVQRVID IFDTDGNGEVDFKEFILGASQFSVRGDEEQKLRFAFSIYDIDKDGFISNGELFQVLKLMV GNNLKDWQLQQLVDKTIIILDQNGDGKISFEEFSAVVGGLEVHKKLVVIV NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atgggaaatgaagccagttacccggaggagatatgctcccgcttcaaccccgatgaaatt aaaaggctaggcaagaggtttaagaagctggacttggactgttcgggctctctgagtgtg gaagagttcatgtccgtgcccgagctgcagcagaacccgttggtgcagcgagtgatcgac atcttcgacaccgacggcaacggagaagtggacttcaaggagttcatcctgggggcctcc cagttcagcgtcaggggggacgaggagcagaagttgaggttcgccttcagcatctacgac attgataaagatggcttcatttccaacggggagctcttccaggtgctgaagctgatggtg ggcaacaacctgaaggactggcagttacagcagctcgtggacaaaaccatcatcatcctg gatcagaatggagacgggaaaatatccttcgaggaattcagcgctgtggtcggaggcctg gaggtccacaagaagttggtggtgattgtgtga

DBGET integrated database retrieval system