KEGG   Leptonychotes weddellii (Weddell seal): 102733229
Entry
102733229         CDS       T08708                                 
Symbol
RAC1
Name
(RefSeq) ras-related C3 botulinum toxin substrate 1
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
lww  Leptonychotes weddellii (Weddell seal)
Pathway
lww04010  MAPK signaling pathway
lww04014  Ras signaling pathway
lww04015  Rap1 signaling pathway
lww04024  cAMP signaling pathway
lww04062  Chemokine signaling pathway
lww04071  Sphingolipid signaling pathway
lww04145  Phagosome
lww04148  Efferocytosis
lww04151  PI3K-Akt signaling pathway
lww04310  Wnt signaling pathway
lww04360  Axon guidance
lww04370  VEGF signaling pathway
lww04380  Osteoclast differentiation
lww04510  Focal adhesion
lww04520  Adherens junction
lww04530  Tight junction
lww04613  Neutrophil extracellular trap formation
lww04620  Toll-like receptor signaling pathway
lww04650  Natural killer cell mediated cytotoxicity
lww04662  B cell receptor signaling pathway
lww04664  Fc epsilon RI signaling pathway
lww04666  Fc gamma R-mediated phagocytosis
lww04670  Leukocyte transendothelial migration
lww04722  Neurotrophin signaling pathway
lww04810  Regulation of actin cytoskeleton
lww04932  Non-alcoholic fatty liver disease
lww04933  AGE-RAGE signaling pathway in diabetic complications
lww04972  Pancreatic secretion
lww05014  Amyotrophic lateral sclerosis
lww05020  Prion disease
lww05022  Pathways of neurodegeneration - multiple diseases
lww05100  Bacterial invasion of epithelial cells
lww05132  Salmonella infection
lww05135  Yersinia infection
lww05163  Human cytomegalovirus infection
lww05167  Kaposi sarcoma-associated herpesvirus infection
lww05169  Epstein-Barr virus infection
lww05170  Human immunodeficiency virus 1 infection
lww05200  Pathways in cancer
lww05203  Viral carcinogenesis
lww05205  Proteoglycans in cancer
lww05208  Chemical carcinogenesis - reactive oxygen species
lww05210  Colorectal cancer
lww05211  Renal cell carcinoma
lww05212  Pancreatic cancer
lww05231  Choline metabolism in cancer
lww05415  Diabetic cardiomyopathy
lww05416  Viral myocarditis
lww05417  Lipid and atherosclerosis
lww05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lww00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102733229 (RAC1)
   04014 Ras signaling pathway
    102733229 (RAC1)
   04015 Rap1 signaling pathway
    102733229 (RAC1)
   04310 Wnt signaling pathway
    102733229 (RAC1)
   04370 VEGF signaling pathway
    102733229 (RAC1)
   04071 Sphingolipid signaling pathway
    102733229 (RAC1)
   04024 cAMP signaling pathway
    102733229 (RAC1)
   04151 PI3K-Akt signaling pathway
    102733229 (RAC1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102733229 (RAC1)
   04148 Efferocytosis
    102733229 (RAC1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102733229 (RAC1)
   04520 Adherens junction
    102733229 (RAC1)
   04530 Tight junction
    102733229 (RAC1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102733229 (RAC1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    102733229 (RAC1)
   04620 Toll-like receptor signaling pathway
    102733229 (RAC1)
   04650 Natural killer cell mediated cytotoxicity
    102733229 (RAC1)
   04662 B cell receptor signaling pathway
    102733229 (RAC1)
   04664 Fc epsilon RI signaling pathway
    102733229 (RAC1)
   04666 Fc gamma R-mediated phagocytosis
    102733229 (RAC1)
   04670 Leukocyte transendothelial migration
    102733229 (RAC1)
   04062 Chemokine signaling pathway
    102733229 (RAC1)
  09154 Digestive system
   04972 Pancreatic secretion
    102733229 (RAC1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102733229 (RAC1)
  09158 Development and regeneration
   04360 Axon guidance
    102733229 (RAC1)
   04380 Osteoclast differentiation
    102733229 (RAC1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102733229 (RAC1)
   05205 Proteoglycans in cancer
    102733229 (RAC1)
   05208 Chemical carcinogenesis - reactive oxygen species
    102733229 (RAC1)
   05203 Viral carcinogenesis
    102733229 (RAC1)
   05231 Choline metabolism in cancer
    102733229 (RAC1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102733229 (RAC1)
   05212 Pancreatic cancer
    102733229 (RAC1)
   05211 Renal cell carcinoma
    102733229 (RAC1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102733229 (RAC1)
   05163 Human cytomegalovirus infection
    102733229 (RAC1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102733229 (RAC1)
   05169 Epstein-Barr virus infection
    102733229 (RAC1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102733229 (RAC1)
   05135 Yersinia infection
    102733229 (RAC1)
   05100 Bacterial invasion of epithelial cells
    102733229 (RAC1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    102733229 (RAC1)
   05020 Prion disease
    102733229 (RAC1)
   05022 Pathways of neurodegeneration - multiple diseases
    102733229 (RAC1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    102733229 (RAC1)
   05418 Fluid shear stress and atherosclerosis
    102733229 (RAC1)
   05415 Diabetic cardiomyopathy
    102733229 (RAC1)
   05416 Viral myocarditis
    102733229 (RAC1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102733229 (RAC1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102733229 (RAC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lww04131]
    102733229 (RAC1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lww04147]
    102733229 (RAC1)
   04031 GTP-binding proteins [BR:lww04031]
    102733229 (RAC1)
Membrane trafficking [BR:lww04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    102733229 (RAC1)
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    102733229 (RAC1)
  Macropinocytosis
   Ras GTPases
    102733229 (RAC1)
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    102733229 (RAC1)
Exosome [BR:lww04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102733229 (RAC1)
  Exosomal proteins of other body fluids (saliva and urine)
   102733229 (RAC1)
  Exosomal proteins of colorectal cancer cells
   102733229 (RAC1)
  Exosomal proteins of bladder cancer cells
   102733229 (RAC1)
GTP-binding proteins [BR:lww04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    102733229 (RAC1)
SSDB
Motif
Pfam: Ras Roc GTP_EFTU CagD Arf
Other DBs
NCBI-GeneID: 102733229
NCBI-ProteinID: XP_030873429
UniProt: A0A7F8PXD9
LinkDB
Position
Unknown
AA seq 148 aa
MVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHH
CPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRG
LKTVFDEAIRAVLCPPPVKKRKRKCLLL
NT seq 447 nt   +upstreamnt  +downstreamnt
atggtagatggaaaaccggtgaatctgggcttatgggatacagctggacaagaagattat
gaccgattacgtcccttatcctatccgcaaacagatgtattcttaatttgcttttctctt
gtgagtcctgcatcatttgaaaatgttcgagcaaagtggtaccccgaagtgcgacatcac
tgtcccaacacccccatcatcttggtggggactaaacttgatctcagggacgacaaagac
acgatcgagaagctgaaggaaaagaagctgacacccatcacctacccgcagggtctggcc
atggctaaggagatcggtgcggtaaaatacctggagtgctcggcactcacgcagcgaggc
ctcaagacagtgtttgatgaagcgattcgagcggttctctgcccccctcccgtcaagaag
aggaagagaaaatgcctgctgttgtaa

DBGET integrated database retrieval system