Leptonychotes weddellii (Weddell seal): 102733719 Help Entry 102733719         CDS       T08708                                  Symbol RAB5B Name (RefSeq) ras-related protein Rab-5B   KO K07888   Ras-related protein Rab-5B Organism lww  Leptonychotes weddellii (Weddell seal) Pathway lww04014   Ras signaling pathway lww04137   Mitophagy - animal lww04144   Endocytosis lww04145   Phagosome lww04148   Efferocytosis lww04962   Vasopressin-regulated water reabsorption lww05132   Salmonella infection lww05146   Amoebiasis lww05152   Tuberculosis Brite KEGG Orthology (KO) [BR:lww00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     102733719 (RAB5B)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     102733719 (RAB5B)    04145 Phagosome     102733719 (RAB5B)    04137 Mitophagy - animal     102733719 (RAB5B)    04148 Efferocytosis     102733719 (RAB5B)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     102733719 (RAB5B)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102733719 (RAB5B)    05152 Tuberculosis     102733719 (RAB5B)   09174 Infectious disease: parasitic    05146 Amoebiasis     102733719 (RAB5B)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lww04131]     102733719 (RAB5B)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lww04147]     102733719 (RAB5B)    04031 GTP-binding proteins [BR:lww04031]     102733719 (RAB5B) Membrane trafficking [BR:lww04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     102733719 (RAB5B)  Endosome - Lysosome transport     102733719 (RAB5B) Exosome [BR:lww04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102733719 (RAB5B)   Exosomal proteins of other body fluids (saliva and urine)    102733719 (RAB5B)   Exosomal proteins of colorectal cancer cells    102733719 (RAB5B)   Exosomal proteins of melanoma cells    102733719 (RAB5B) GTP-binding proteins [BR:lww04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     102733719 (RAB5B) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 Gtr1_RagA RsgA_GTPase AAA_16 Motif Other DBs NCBI-GeneID:  102733719 NCBI-ProteinID:  XP_006728826 UniProt:  A0A2U3XBJ7 LinkDB All DBs Position Unknown AA seq 215 aa AA seqDB search MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQ SVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQR QASPSIVIALAGNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKK LPKSEPQNLGGAAGRSRGVDLHEQSQQNKSQCCSN NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgactagcagaagcacagccaggcccaatgggcagccccaggccagcaaaatatgccag ttcaaattggtcctgctgggtgaatctgcagtggggaagtctagcctggtattacgtttt gtcaaagggcagttccatgagtaccaggagagcactattggagcggccttcctcacccag tctgtttgtctagatgacacaacagtcaagtttgagatctgggacacagctgggcaggaa cgataccatagcttggcccccatgtactacagaggtgcccaagctgccattgtggtttat gacattactaatcaggaaaccttcgcccgagcaaagacatgggtaaaggaactacagcga caggccagtcctagcatcgttattgccctggcggggaacaaagctgacctggccaataag cgcatggtggagtatgaagaggcccaggcctatgcagatgacaacagcttattgtttatg gagacttcagccaagacagctatgaacgtgaacgatctcttcctggcaatagctaagaag ttgccaaagagtgaaccccagaatctggggggtgcagcaggccgaagccgaggcgtggat ctccatgagcagtcccagcagaacaagagccagtgctgtagcaactga

DBGET integrated database retrieval system