Leptonychotes weddellii (Weddell seal): 102734216 Help Entry 102734216         CDS       T08708                                  Symbol PSMB5 Name (RefSeq) proteasome subunit beta type-5   KO K02737   20S proteasome subunit beta 5 [EC:3.4.25.1] Organism lww  Leptonychotes weddellii (Weddell seal) Pathway lww03050   Proteasome lww05010   Alzheimer disease lww05012   Parkinson disease lww05014   Amyotrophic lateral sclerosis lww05016   Huntington disease lww05017   Spinocerebellar ataxia lww05020   Prion disease lww05022   Pathways of neurodegeneration - multiple diseases Brite KEGG Orthology (KO) [BR:lww00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     102734216 (PSMB5)  09160 Human Diseases   09164 Neurodegenerative disease    05010 Alzheimer disease     102734216 (PSMB5)    05012 Parkinson disease     102734216 (PSMB5)    05014 Amyotrophic lateral sclerosis     102734216 (PSMB5)    05016 Huntington disease     102734216 (PSMB5)    05017 Spinocerebellar ataxia     102734216 (PSMB5)    05020 Prion disease     102734216 (PSMB5)    05022 Pathways of neurodegeneration - multiple diseases     102734216 (PSMB5)  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:lww01002]     102734216 (PSMB5)   09182 Protein families: genetic information processing    03051 Proteasome [BR:lww03051]     102734216 (PSMB5) Enzymes [BR:lww01000]  3. Hydrolases   3.4  Acting on peptide bonds (peptidases)    3.4.25  Threonine endopeptidases     3.4.25.1  proteasome endopeptidase complex      102734216 (PSMB5) Peptidases and inhibitors [BR:lww01002]  Threonine peptidases   Family T1: proteasome family    102734216 (PSMB5) Proteasome [BR:lww03051]  Eukaryotic proteasome   Core particles (20S proteasome)    beta type subunits     102734216 (PSMB5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Proteasome Motif Other DBs NCBI-GeneID:  102734216 NCBI-ProteinID:  XP_006746559 UniProt:  A0A2U3YS54 LinkDB All DBs Position Unknown AA seq 160 aa AA seqDB search MALASVLERPLPVNGLGFFGLGGRADLLDLGPGSPSDGLSLAAPNWGVAEEPRIEMLHGT TTLAFKFQHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLAR QCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMI NT seq 480 nt NT seq  +upstreamnt  +downstreamnt atggcgctggccagcgtgttggagaggccgctcccggtgaacgggctcgggtttttcgga ctcgggggtcgtgcggatctgctggacctgggtccagggagtcccagcgatgggctgagc ctggccgcgcccaactggggtgtcgcggaggagccgaggatcgaaatgcttcatggaacc actaccctggccttcaagtttcaacatggagtcatcgttgcagcggactctcgggccaca gcgggtgcctatatagcctcccagacagtaaagaaggtgatcgagatcaatccctacctg ctgggcaccatggctgggggcgcagcggactgcagcttctgggagcggctgttggctcgg caatgtcgcatctatgagcttcgaaacaaggaacgcatctcggtagcagctgcctccaag ctgcttgccaacatggtgtatcagtataaaggcatggggctgtccatgggcaccatgatc

DBGET integrated database retrieval system