Leptonychotes weddellii (Weddell seal): 102736343 Help Entry 102736343         CDS       T08708                                  Name (RefSeq) thioredoxin-like isoform X1   KO K03671   thioredoxin Organism lww  Leptonychotes weddellii (Weddell seal) Pathway lww04621   NOD-like receptor signaling pathway lww05012   Parkinson disease lww05132   Salmonella infection lww05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:lww00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     102736343  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102736343   09164 Neurodegenerative disease    05012 Parkinson disease     102736343   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     102736343  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:lww03110]     102736343 Chaperones and folding catalysts [BR:lww03110]  Protein folding catalysts   Protein disulfide isomerase    102736343 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Thioredoxin DIM1 Thioredoxin_8 Thioredoxin_2 Thioredoxin_7 Motif Other DBs NCBI-GeneID:  102736343 NCBI-ProteinID:  XP_030878428 UniProt:  A0A7F8QDU6 LinkDB All DBs Position Unknown AA seq 96 aa AA seqDB search MVKQIKSKYAFQEAVNSARDKLVVVDFSAIWCGPCKMIKLSLFEKYSNVVSLEVDVDDCQ DVASECEVKCMPTFQFFFFKKGQKVGEFSGANKGKL NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atggtgaagcagataaagagcaagtatgcttttcaggaagccgtgaacagtgcaagagat aaactagttgtagttgacttctcagccatatggtgtgggccttgcaaaatgatcaagctt tccctctttgagaagtattccaatgtggtatcccttgaagtagatgtggatgattgtcag gatgttgcttcagaatgtgaagtcaaatgcatgccaaccttccagttttttttttttaaa aagggacaaaaggtgggtgaattttctggtgctaataagggaaaactttaa

DBGET integrated database retrieval system