Leptonychotes weddellii (Weddell seal): 102737756 Help Entry 102737756         CDS       T08708                                  Symbol CXCL8 Name (RefSeq) interleukin-8   KO K10030   interleukin 8 Organism lww  Leptonychotes weddellii (Weddell seal) Pathway lww04060   Cytokine-cytokine receptor interaction lww04061   Viral protein interaction with cytokine and cytokine receptor lww04062   Chemokine signaling pathway lww04064   NF-kappa B signaling pathway lww04072   Phospholipase D signaling pathway lww04218   Cellular senescence lww04620   Toll-like receptor signaling pathway lww04621   NOD-like receptor signaling pathway lww04622   RIG-I-like receptor signaling pathway lww04657   IL-17 signaling pathway lww04932   Non-alcoholic fatty liver disease lww04933   AGE-RAGE signaling pathway in diabetic complications lww04936   Alcoholic liver disease lww05132   Salmonella infection lww05133   Pertussis lww05134   Legionellosis lww05135   Yersinia infection lww05142   Chagas disease lww05144   Malaria lww05146   Amoebiasis lww05161   Hepatitis B lww05163   Human cytomegalovirus infection lww05164   Influenza A lww05167   Kaposi sarcoma-associated herpesvirus infection lww05171   Coronavirus disease - COVID-19 lww05200   Pathways in cancer lww05202   Transcriptional misregulation in cancer lww05219   Bladder cancer lww05323   Rheumatoid arthritis lww05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:lww00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     102737756 (CXCL8)    04072 Phospholipase D signaling pathway     102737756 (CXCL8)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102737756 (CXCL8)    04061 Viral protein interaction with cytokine and cytokine receptor     102737756 (CXCL8)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     102737756 (CXCL8)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102737756 (CXCL8)    04621 NOD-like receptor signaling pathway     102737756 (CXCL8)    04622 RIG-I-like receptor signaling pathway     102737756 (CXCL8)    04657 IL-17 signaling pathway     102737756 (CXCL8)    04062 Chemokine signaling pathway     102737756 (CXCL8)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102737756 (CXCL8)    05202 Transcriptional misregulation in cancer     102737756 (CXCL8)   09162 Cancer: specific types    05219 Bladder cancer     102737756 (CXCL8)   09172 Infectious disease: viral    05161 Hepatitis B     102737756 (CXCL8)    05171 Coronavirus disease - COVID-19     102737756 (CXCL8)    05164 Influenza A     102737756 (CXCL8)    05163 Human cytomegalovirus infection     102737756 (CXCL8)    05167 Kaposi sarcoma-associated herpesvirus infection     102737756 (CXCL8)   09171 Infectious disease: bacterial    05132 Salmonella infection     102737756 (CXCL8)    05135 Yersinia infection     102737756 (CXCL8)    05133 Pertussis     102737756 (CXCL8)    05134 Legionellosis     102737756 (CXCL8)   09174 Infectious disease: parasitic    05146 Amoebiasis     102737756 (CXCL8)    05144 Malaria     102737756 (CXCL8)    05142 Chagas disease     102737756 (CXCL8)   09163 Immune disease    05323 Rheumatoid arthritis     102737756 (CXCL8)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102737756 (CXCL8)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     102737756 (CXCL8)    04932 Non-alcoholic fatty liver disease     102737756 (CXCL8)    04933 AGE-RAGE signaling pathway in diabetic complications     102737756 (CXCL8)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:lww04052]     102737756 (CXCL8)    00536 Glycosaminoglycan binding proteins [BR:lww00536]     102737756 (CXCL8) Cytokines and neuropeptides [BR:lww04052]  Cytokines   Chemokines    102737756 (CXCL8) Glycosaminoglycan binding proteins [BR:lww00536]  Heparan sulfate / Heparin   Chemokines    102737756 (CXCL8) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 DUF5527 Motif Other DBs NCBI-GeneID:  102737756 NCBI-ProteinID:  XP_006729872 UniProt:  A0A2U3XEG2 LinkDB All DBs Position Unknown AA seq 104 aa AA seqDB search MTSKLAIALLAVFLLFAALCEAAVLSRMSSELRCQCINTHSSPFHPKYIKELRVIDSGPH CENSEIIVKLVNGKEVCLDPKERWVQKVVQMFLKRAEKQESLNK NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgacttccaagctggctattgctcttttggcagttttcctgctttttgcagctctgtgt gaagccgcagttctgtcaagaatgagttcagaacttcgatgccagtgcataaatactcac tcctcgcctttccatcccaaatatatcaaagaactgagagtaattgacagcggcccacat tgtgaaaactcagaaatcattgtaaagcttgtcaatggaaaagaggtgtgcctggacccc aaggaaagatgggtacagaaggttgtgcagatgtttttgaagagggctgagaaacaggaa tcattaaacaaataa

DBGET integrated database retrieval system