Leptonychotes weddellii (Weddell seal): 102737793 Help Entry 102737793         CDS       T08708                                  Symbol RAB8A Name (RefSeq) ras-related protein Rab-8A   KO K07901   Ras-related protein Rab-8A Organism lww  Leptonychotes weddellii (Weddell seal) Pathway lww04140   Autophagy - animal lww04144   Endocytosis lww04152   AMPK signaling pathway lww04530   Tight junction lww04972   Pancreatic secretion lww05014   Amyotrophic lateral sclerosis lww05022   Pathways of neurodegeneration - multiple diseases Brite KEGG Orthology (KO) [BR:lww00001]  09130 Environmental Information Processing   09132 Signal transduction    04152 AMPK signaling pathway     102737793 (RAB8A)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     102737793 (RAB8A)    04140 Autophagy - animal     102737793 (RAB8A)   09144 Cellular community - eukaryotes    04530 Tight junction     102737793 (RAB8A)  09150 Organismal Systems   09154 Digestive system    04972 Pancreatic secretion     102737793 (RAB8A)  09160 Human Diseases   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     102737793 (RAB8A)    05022 Pathways of neurodegeneration - multiple diseases     102737793 (RAB8A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lww04131]     102737793 (RAB8A)    03036 Chromosome and associated proteins [BR:lww03036]     102737793 (RAB8A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lww04147]     102737793 (RAB8A)    04031 GTP-binding proteins [BR:lww04031]     102737793 (RAB8A) Membrane trafficking [BR:lww04131]  Exocytosis   Small GTPases and associated proteins    Rab GTPases     102737793 (RAB8A)  Autophagy   Other autophagy associated proteins     102737793 (RAB8A) Chromosome and associated proteins [BR:lww03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     102737793 (RAB8A) Exosome [BR:lww04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102737793 (RAB8A)   Exosomal proteins of other body fluids (saliva and urine)    102737793 (RAB8A)   Exosomal proteins of colorectal cancer cells    102737793 (RAB8A) GTP-binding proteins [BR:lww04031]  Small (monomeric) G-proteins   Rab Family    Rab8/10/13 [OT]     102737793 (RAB8A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf Gtr1_RagA GTP_EFTU SRPRB MMR_HSR1 DUF3963 Septin AAA_7 Motif Other DBs NCBI-GeneID:  102737793 NCBI-ProteinID:  XP_006736129 UniProt:  A0A2U3XXE9 LinkDB All DBs Position Unknown AA seq 207 aa AA seqDB search MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQ IWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILG NKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGN SPQGSNQGVKITPDQQKRSGFFRCVLL NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atggcgaagacctacgattacctgttcaagctgctgctgatcggggactcgggggtgggg aagacctgtgtcctgttccgcttctccgaggacgccttcaactcaactttcatctccacc ataggaattgactttaaaattaggaccatagagctcgatggcaagagaattaagctgcaa atatgggacacagctggtcaggaacggtttcggacgatcacgacagcctactacaggggc gcaatgggcatcatgctggtctatgacatcaccaacgagaaatcctttgacaacatccgg aactggattcggaacattgaggagcatgcttctgcagatgtcgaaaagatgatactcggg aacaagtgtgacgtgaacgacaagagacaagtttccaaggaacggggagaaaagctggcc ctggactacggaatcaagttcatggagaccagtgcgaaggccaacatcaatgtggagaac gcatttttcactctcgccagagacatcaaagcaaaaatggacaaaaaattggaaggcaat agtccccaagggagcaaccagggagtcaaaatcacaccagaccagcagaagaggagcggc tttttccgatgtgttcttctgtga

DBGET integrated database retrieval system