Leptonychotes weddellii (Weddell seal): 102739018 Help Entry 102739018         CDS       T08708                                  Symbol RAB7A Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism lww  Leptonychotes weddellii (Weddell seal) Pathway lww04137   Mitophagy - animal lww04140   Autophagy - animal lww04144   Endocytosis lww04145   Phagosome lww04148   Efferocytosis lww05132   Salmonella infection lww05146   Amoebiasis lww05152   Tuberculosis Brite KEGG Orthology (KO) [BR:lww00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     102739018 (RAB7A)    04145 Phagosome     102739018 (RAB7A)    04140 Autophagy - animal     102739018 (RAB7A)    04137 Mitophagy - animal     102739018 (RAB7A)    04148 Efferocytosis     102739018 (RAB7A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102739018 (RAB7A)    05152 Tuberculosis     102739018 (RAB7A)   09174 Infectious disease: parasitic    05146 Amoebiasis     102739018 (RAB7A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lww04131]     102739018 (RAB7A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lww04147]     102739018 (RAB7A)    04031 GTP-binding proteins [BR:lww04031]     102739018 (RAB7A) Membrane trafficking [BR:lww04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     102739018 (RAB7A) Exosome [BR:lww04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102739018 (RAB7A)   Exosomal proteins of other body fluids (saliva and urine)    102739018 (RAB7A)   Exosomal proteins of colorectal cancer cells    102739018 (RAB7A)   Exosomal proteins of bladder cancer cells    102739018 (RAB7A) GTP-binding proteins [BR:lww04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     102739018 (RAB7A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA ATP_bind_1 cobW nSTAND3 PduV-EutP Septin AAA_7 NTPase_1 AAA_22 AAA_16 AAA_24 G-alpha AAA_5 ATPase_2 NACHT AAA_14 NB-ARC SRPRB ATP-synt_ab ABC_tran Motif Other DBs NCBI-GeneID:  102739018 NCBI-ProteinID:  XP_006742464 UniProt:  A0A2U3YFG6 LinkDB All DBs Position Unknown AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVATKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDKNDRAKPSGESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacctctaggaagaaagtgttgctgaaggttatcatcctgggagattctggagttggt aagacatcactcatgaaccagtatgtgaacaagaaattcagtaatcagtacaaagctaca ataggagcagactttctgacaaaggaggtgatggtggatgacagactagttacaatgcag atctgggacacagcaggccaggaacggttccagtcacttggtgtggccttctacagaggc gcagactgctgcgttctggtatttgacgttactgcccccaacacattcaaaaccctcgat agctggagagatgagtttctcatccaggccagtccccgggatcctgaaaacttccccttt gttgtgttgggaaacaagattgacctcgaaaacagacaagtggccacaaagcgggcacag gcctggtgctacagcaaaaacaacattccctacttcgagaccagtgccaaggaggccatc aatgtggagcaggcgttccagacaattgcacggaatgcacttaaacaggaaacagaggtg gagctgtacaacgaattccccgaacccatcaaactggacaagaatgaccgggccaagcct tcaggggaaagctgcagttgctga

DBGET integrated database retrieval system