Leptonychotes weddellii (Weddell seal): 102739066 Help Entry 102739066         CDS       T08708                                  Symbol RHEB Name (RefSeq) GTP-binding protein Rheb   KO K07208   Ras homolog enriched in brain Organism lww  Leptonychotes weddellii (Weddell seal) Pathway lww04072   Phospholipase D signaling pathway lww04140   Autophagy - animal lww04150   mTOR signaling pathway lww04151   PI3K-Akt signaling pathway lww04152   AMPK signaling pathway lww04211   Longevity regulating pathway lww04218   Cellular senescence lww04714   Thermogenesis lww04910   Insulin signaling pathway lww04919   Thyroid hormone signaling pathway lww05163   Human cytomegalovirus infection lww05165   Human papillomavirus infection lww05168   Herpes simplex virus 1 infection lww05231   Choline metabolism in cancer Brite KEGG Orthology (KO) [BR:lww00001]  09130 Environmental Information Processing   09132 Signal transduction    04072 Phospholipase D signaling pathway     102739066 (RHEB)    04151 PI3K-Akt signaling pathway     102739066 (RHEB)    04152 AMPK signaling pathway     102739066 (RHEB)    04150 mTOR signaling pathway     102739066 (RHEB)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102739066 (RHEB)   09143 Cell growth and death    04218 Cellular senescence     102739066 (RHEB)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     102739066 (RHEB)    04919 Thyroid hormone signaling pathway     102739066 (RHEB)   09149 Aging    04211 Longevity regulating pathway     102739066 (RHEB)   09159 Environmental adaptation    04714 Thermogenesis     102739066 (RHEB)  09160 Human Diseases   09161 Cancer: overview    05231 Choline metabolism in cancer     102739066 (RHEB)   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     102739066 (RHEB)    05163 Human cytomegalovirus infection     102739066 (RHEB)    05165 Human papillomavirus infection     102739066 (RHEB)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:lww04031]     102739066 (RHEB) GTP-binding proteins [BR:lww04031]  Small (monomeric) G-proteins   Ras Family    Rheb     102739066 (RHEB) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf RsgA_GTPase RhoGAP_pG1_pG2 DUF1842 Motif Other DBs NCBI-GeneID:  102739066 NCBI-ProteinID:  XP_006730956 UniProt:  A0A2U3XHN5 LinkDB All DBs Position Unknown AA seq 148 aa AA seqDB search LFFPVAFTKLITVNGQEYHLQLVDTAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVI KVIHGKLLDMVGKVQIPIMLVGNKKDLHMERVISYEEGKALAESWNAAFLESSAKENQTA VDVFRRIILEAEKIDGAASQGKSSCSVM NT seq 447 nt NT seq  +upstreamnt  +downstreamnt ctttttttccctgtagctttcacaaaattgatcacagtcaatggacaagaatatcatctt caacttgtcgacacagcagggcaagatgaatactccatctttcctcagacatactccata gatattaatggttacattcttgtgtattctgttacatcaatcaaaagttttgaagtgatt aaagttattcatggcaaattgttggacatggtggggaaagtgcaaatacctattatgttg gttggaaataagaaagacctccatatggaaagggtgatcagttatgaagaagggaaagcg ttagcagagtcttggaatgcggctttcttggaatcttctgctaaagaaaatcagacggct gttgatgtctttagaaggataattttggaggcagaaaaaattgacggggccgcttcacaa ggaaagtcgtcctgctcggtgatgtaa

DBGET integrated database retrieval system