Leptonychotes weddellii (Weddell seal): 102742200 Help Entry 102742200         CDS       T08708                                  Symbol IL2 Name (RefSeq) interleukin-2   KO K05429   interleukin 2 Organism lww  Leptonychotes weddellii (Weddell seal) Pathway lww04060   Cytokine-cytokine receptor interaction lww04061   Viral protein interaction with cytokine and cytokine receptor lww04151   PI3K-Akt signaling pathway lww04625   C-type lectin receptor signaling pathway lww04630   JAK-STAT signaling pathway lww04658   Th1 and Th2 cell differentiation lww04659   Th17 cell differentiation lww04660   T cell receptor signaling pathway lww04672   Intestinal immune network for IgA production lww04940   Type I diabetes mellitus lww05135   Yersinia infection lww05142   Chagas disease lww05162   Measles lww05166   Human T-cell leukemia virus 1 infection lww05171   Coronavirus disease - COVID-19 lww05200   Pathways in cancer lww05320   Autoimmune thyroid disease lww05321   Inflammatory bowel disease lww05330   Allograft rejection lww05332   Graft-versus-host disease Brite KEGG Orthology (KO) [BR:lww00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     102742200 (IL2)    04151 PI3K-Akt signaling pathway     102742200 (IL2)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102742200 (IL2)    04061 Viral protein interaction with cytokine and cytokine receptor     102742200 (IL2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     102742200 (IL2)    04660 T cell receptor signaling pathway     102742200 (IL2)    04658 Th1 and Th2 cell differentiation     102742200 (IL2)    04659 Th17 cell differentiation     102742200 (IL2)    04672 Intestinal immune network for IgA production     102742200 (IL2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102742200 (IL2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102742200 (IL2)    05171 Coronavirus disease - COVID-19     102742200 (IL2)    05162 Measles     102742200 (IL2)   09171 Infectious disease: bacterial    05135 Yersinia infection     102742200 (IL2)   09174 Infectious disease: parasitic    05142 Chagas disease     102742200 (IL2)   09163 Immune disease    05320 Autoimmune thyroid disease     102742200 (IL2)    05321 Inflammatory bowel disease     102742200 (IL2)    05330 Allograft rejection     102742200 (IL2)    05332 Graft-versus-host disease     102742200 (IL2)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     102742200 (IL2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:lww04052]     102742200 (IL2)    00536 Glycosaminoglycan binding proteins [BR:lww00536]     102742200 (IL2) Cytokines and neuropeptides [BR:lww04052]  Cytokines   Interleukins    102742200 (IL2) Glycosaminoglycan binding proteins [BR:lww00536]  Heparan sulfate / Heparin   Cytokines    102742200 (IL2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL2 Motif Other DBs NCBI-GeneID:  102742200 NCBI-ProteinID:  XP_006738235 UniProt:  A0A2U3Y3E4 LinkDB All DBs Position Unknown AA seq 154 aa AA seqDB search MYKMQLLSCIALTLVLVANSAPTTSSTKETQQQLEQLLLDLRLLLNGVNNYEDPKLSRML TFKFYTPKKATELTHLQCLAEELKLLEEVLYLAQSKNFHLTDIKELMSNINVTLLKLKGS ETRFKCEYDDETATITEFLNKWITFCQSIFSTLT NT seq 465 nt NT seq  +upstreamnt  +downstreamnt atgtacaaaatgcaactcttgtcttgcatcgcactgactcttgtacttgtcgcaaacagt gcacctactacttcgtctacgaaggaaacacagcaacagttggagcaattgctgctggat ttacggttgctcttgaatggagttaataattatgaggaccctaaactctccaggatgctc acgtttaaattctacacgcccaagaaggccacagaattgacacatcttcaatgtctagca gaagaactcaaacttctggaggaagtgctatatttagctcaaagcaaaaactttcacttg acagacatcaaggaattaatgagcaatatcaatgtaacacttctgaaactaaagggatct gaaacaagattcaaatgtgaatatgatgacgagacagcaaccattacagaatttctgaac aaatggattactttttgtcaaagcatcttctcaacactgacttga

DBGET integrated database retrieval system