Leptonychotes weddellii (Weddell seal): 102742869 Help Entry 102742869         CDS       T08708                                  Name (RefSeq) protein S100-A10   KO K17274   protein S100-A10 Organism lww  Leptonychotes weddellii (Weddell seal) Pathway lww04382   Cornified envelope formation lww05132   Salmonella infection Brite KEGG Orthology (KO) [BR:lww00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     102742869  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102742869  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lww04147]     102742869 Exosome [BR:lww04147]  Exosomal proteins   Exosomal proteins of microglial cells    102742869 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EFhand_Ca_insen EF-hand_8 EF-hand_6 TMP_3 Motif Other DBs NCBI-GeneID:  102742869 NCBI-ProteinID:  XP_030879040 UniProt:  A0A2U3XAI3 LinkDB All DBs Position Unknown AA seq 97 aa AA seqDB search MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLD QCRDGKVGFQSFFSLIAGLTIACNDYFVIHMKQKGKK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgccgtctcaaatggaacatgccatggaaaccatgatgttcacgtttcacaagtttgct ggggataaaggctacttaacaaaggaggacctgagagtactcatggaaaaggagttccct ggatttttggaaaatcaaaaagaccctctggctgtggacaaaataatgaaggacctggac cagtgccgagacggcaaagtgggcttccagagcttcttctcgctaattgctgggctcacc atcgcatgcaatgactatttcgtaatacacatgaagcagaagggaaagaagtag

DBGET integrated database retrieval system