Leptonychotes weddellii (Weddell seal): 102742876 Help Entry 102742876         CDS       T08708                                  Symbol PFN3 Name (RefSeq) profilin-3   KO K05759   profilin Organism lww  Leptonychotes weddellii (Weddell seal) Pathway lww04015   Rap1 signaling pathway lww04810   Regulation of actin cytoskeleton lww05014   Amyotrophic lateral sclerosis lww05132   Salmonella infection Brite KEGG Orthology (KO) [BR:lww00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     102742876 (PFN3)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     102742876 (PFN3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102742876 (PFN3)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     102742876 (PFN3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lww04131]     102742876 (PFN3)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:lww04812]     102742876 (PFN3)    04147 Exosome [BR:lww04147]     102742876 (PFN3) Membrane trafficking [BR:lww04131]  Others   Actin-binding proteins    Others     102742876 (PFN3) Cytoskeleton proteins [BR:lww04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      102742876 (PFN3) Exosome [BR:lww04147]  Exosomal proteins   Proteins found in most exosomes    102742876 (PFN3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  102742876 NCBI-ProteinID:  XP_006733201 UniProt:  A0A2U3XP05 LinkDB All DBs Position Unknown AA seq 137 aa AA seqDB search MGDWKSYISAVLRDQRIDDVAIVGHSDNRCVWASRPGGLLAAISPQEVGVLTGPDRRTFL QSGLSVAGRRCCVIRDHLLSEGDGVLDARTKGLDGRAVCVGHTPRVLLVLMGRRGVHGGI LNKTVHKLIKGLLMQGT NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgggagactggaaaagctatatcagtgcggtgctgcgggaccagcgcattgacgacgtg gccatcgtgggtcactcggacaatcgctgcgtgtgggcatcgcgccccggaggccttctg gctgccatatcaccgcaagaggtgggtgtgctcacgggtcctgaccggcgcaccttcctg cagtcaggcctgagcgtggcaggccgccgctgctgcgtcatccgcgaccacttgctgtct gagggcgatggagttctggacgcacgcactaaagggctggatggacgcgcggtctgcgtg ggccacaccccacgtgtgctcctcgtgctcatgggccggcgcggcgtgcacgggggcatc ctcaacaagacagtgcataaactgatcaaggggctactcatgcagggcacctag

DBGET integrated database retrieval system