Leptonychotes weddellii (Weddell seal): 102745769 Help Entry 102745769         CDS       T08708                                  Name (RefSeq) histone H2B type 1 isoform X1   KO K11252   histone H2B Organism lww  Leptonychotes weddellii (Weddell seal) Pathway lww04613   Neutrophil extracellular trap formation lww05034   Alcoholism lww05203   Viral carcinogenesis lww05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:lww00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102745769  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     102745769   09163 Immune disease    05322 Systemic lupus erythematosus     102745769   09165 Substance dependence    05034 Alcoholism     102745769  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:lww03036]     102745769   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lww04147]     102745769 Chromosome and associated proteins [BR:lww03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102745769 Exosome [BR:lww04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102745769 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa Motif Other DBs NCBI-GeneID:  102745769 NCBI-ProteinID:  XP_030886663 UniProt:  A0A7F8R1Y0 LinkDB All DBs Position Unknown AA seq 138 aa AA seqDB search MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSNCPEKAIVTTLDC NT seq 417 nt NT seq  +upstreamnt  +downstreamnt atgcccgagcccgccaagtcggctccggccccgaagaagggctccaagaaggcggtgacc aaggcgcagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactcggtg tacgtgtacaaggtgctgaagcaggtgcaccccgacacgggcatctcgtccaaggccatg ggcatcatgaactcgttcgtcaacgacatcttcgagcgcatcgcgggcgaggcgtcccgc ctggcgcattacaacaagcgctcgaccatcacgtcgcgggagatccagacggccgtgcgc ctgctgctgcccggggagctggccaagcacgccgtgtccgagggcaccaaggccgtcacc aagtacaccagctccaactgccctgaaaaggcgatcgtcactacacttgattgttag

DBGET integrated database retrieval system