Leptonychotes weddellii (Weddell seal): 102746119 Help Entry 102746119         CDS       T08708                                  Symbol TXN Name (RefSeq) thioredoxin   KO K03671   thioredoxin Organism lww  Leptonychotes weddellii (Weddell seal) Pathway lww04621   NOD-like receptor signaling pathway lww05012   Parkinson disease lww05132   Salmonella infection lww05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:lww00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     102746119 (TXN)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102746119 (TXN)   09164 Neurodegenerative disease    05012 Parkinson disease     102746119 (TXN)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     102746119 (TXN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:lww03110]     102746119 (TXN) Chaperones and folding catalysts [BR:lww03110]  Protein folding catalysts   Protein disulfide isomerase    102746119 (TXN) SSDB OrthologParalogGFIT Motif Pfam:  Thioredoxin Thioredoxin_2 Thioredoxin_8 DIM1 OST3_OST6 A6-like_Thioredoxin-like_C AhpC-TSA Thioredoxin_9 Thioredoxin_7 Glutaredoxin Redoxin PedC-like Motif Other DBs NCBI-GeneID:  102746119 NCBI-ProteinID:  XP_006744110 UniProt:  A0A2U3YK60 LinkDB All DBs Position Unknown AA seq 105 aa AA seqDB search MVKQIESKYAFQEALNSAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVVFLEVDVD DCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELI NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggtgaagcagatcgagagcaagtatgcttttcaggaagccttgaacagtgcaggggat aaacttgtagtagttgacttctcagccacgtggtgcgggccttgcaaaatgatcaagcct ttctttcattccctctctgagaagtattccaacgtggtgttccttgaagtagacgtggat gactgtcaggatgttgcttcagagtgtgaagtcaaatgcatgccaaccttccagtttttt aaaaagggtcagaaggtgggtgaattttctggagctaataaggaaaaacttgaagccacc ataaatgaattaatctaa

DBGET integrated database retrieval system