KEGG   Leptonychotes weddellii (Weddell seal): 102746431
Entry
102746431         CDS       T08708                                 
Symbol
NRAS
Name
(RefSeq) GTPase NRas
  KO
K07828  GTPase NRas
Organism
lww  Leptonychotes weddellii (Weddell seal)
Pathway
lww01521  EGFR tyrosine kinase inhibitor resistance
lww01522  Endocrine resistance
lww04010  MAPK signaling pathway
lww04012  ErbB signaling pathway
lww04014  Ras signaling pathway
lww04015  Rap1 signaling pathway
lww04062  Chemokine signaling pathway
lww04068  FoxO signaling pathway
lww04071  Sphingolipid signaling pathway
lww04072  Phospholipase D signaling pathway
lww04137  Mitophagy - animal
lww04140  Autophagy - animal
lww04150  mTOR signaling pathway
lww04151  PI3K-Akt signaling pathway
lww04210  Apoptosis
lww04211  Longevity regulating pathway
lww04213  Longevity regulating pathway - multiple species
lww04218  Cellular senescence
lww04360  Axon guidance
lww04370  VEGF signaling pathway
lww04371  Apelin signaling pathway
lww04540  Gap junction
lww04550  Signaling pathways regulating pluripotency of stem cells
lww04625  C-type lectin receptor signaling pathway
lww04650  Natural killer cell mediated cytotoxicity
lww04660  T cell receptor signaling pathway
lww04662  B cell receptor signaling pathway
lww04664  Fc epsilon RI signaling pathway
lww04714  Thermogenesis
lww04720  Long-term potentiation
lww04722  Neurotrophin signaling pathway
lww04725  Cholinergic synapse
lww04726  Serotonergic synapse
lww04730  Long-term depression
lww04810  Regulation of actin cytoskeleton
lww04910  Insulin signaling pathway
lww04912  GnRH signaling pathway
lww04915  Estrogen signaling pathway
lww04916  Melanogenesis
lww04917  Prolactin signaling pathway
lww04919  Thyroid hormone signaling pathway
lww04921  Oxytocin signaling pathway
lww04926  Relaxin signaling pathway
lww04929  GnRH secretion
lww04933  AGE-RAGE signaling pathway in diabetic complications
lww04935  Growth hormone synthesis, secretion and action
lww05010  Alzheimer disease
lww05022  Pathways of neurodegeneration - multiple diseases
lww05034  Alcoholism
lww05160  Hepatitis C
lww05161  Hepatitis B
lww05163  Human cytomegalovirus infection
lww05165  Human papillomavirus infection
lww05166  Human T-cell leukemia virus 1 infection
lww05167  Kaposi sarcoma-associated herpesvirus infection
lww05170  Human immunodeficiency virus 1 infection
lww05200  Pathways in cancer
lww05203  Viral carcinogenesis
lww05205  Proteoglycans in cancer
lww05206  MicroRNAs in cancer
lww05207  Chemical carcinogenesis - receptor activation
lww05208  Chemical carcinogenesis - reactive oxygen species
lww05210  Colorectal cancer
lww05211  Renal cell carcinoma
lww05213  Endometrial cancer
lww05214  Glioma
lww05215  Prostate cancer
lww05216  Thyroid cancer
lww05218  Melanoma
lww05219  Bladder cancer
lww05220  Chronic myeloid leukemia
lww05221  Acute myeloid leukemia
lww05223  Non-small cell lung cancer
lww05224  Breast cancer
lww05225  Hepatocellular carcinoma
lww05226  Gastric cancer
lww05230  Central carbon metabolism in cancer
lww05231  Choline metabolism in cancer
lww05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
lww05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lww00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102746431 (NRAS)
   04012 ErbB signaling pathway
    102746431 (NRAS)
   04014 Ras signaling pathway
    102746431 (NRAS)
   04015 Rap1 signaling pathway
    102746431 (NRAS)
   04370 VEGF signaling pathway
    102746431 (NRAS)
   04371 Apelin signaling pathway
    102746431 (NRAS)
   04068 FoxO signaling pathway
    102746431 (NRAS)
   04072 Phospholipase D signaling pathway
    102746431 (NRAS)
   04071 Sphingolipid signaling pathway
    102746431 (NRAS)
   04151 PI3K-Akt signaling pathway
    102746431 (NRAS)
   04150 mTOR signaling pathway
    102746431 (NRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102746431 (NRAS)
   04137 Mitophagy - animal
    102746431 (NRAS)
  09143 Cell growth and death
   04210 Apoptosis
    102746431 (NRAS)
   04218 Cellular senescence
    102746431 (NRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102746431 (NRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    102746431 (NRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102746431 (NRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102746431 (NRAS)
   04650 Natural killer cell mediated cytotoxicity
    102746431 (NRAS)
   04660 T cell receptor signaling pathway
    102746431 (NRAS)
   04662 B cell receptor signaling pathway
    102746431 (NRAS)
   04664 Fc epsilon RI signaling pathway
    102746431 (NRAS)
   04062 Chemokine signaling pathway
    102746431 (NRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102746431 (NRAS)
   04929 GnRH secretion
    102746431 (NRAS)
   04912 GnRH signaling pathway
    102746431 (NRAS)
   04915 Estrogen signaling pathway
    102746431 (NRAS)
   04917 Prolactin signaling pathway
    102746431 (NRAS)
   04921 Oxytocin signaling pathway
    102746431 (NRAS)
   04926 Relaxin signaling pathway
    102746431 (NRAS)
   04935 Growth hormone synthesis, secretion and action
    102746431 (NRAS)
   04919 Thyroid hormone signaling pathway
    102746431 (NRAS)
   04916 Melanogenesis
    102746431 (NRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    102746431 (NRAS)
   04726 Serotonergic synapse
    102746431 (NRAS)
   04720 Long-term potentiation
    102746431 (NRAS)
   04730 Long-term depression
    102746431 (NRAS)
   04722 Neurotrophin signaling pathway
    102746431 (NRAS)
  09158 Development and regeneration
   04360 Axon guidance
    102746431 (NRAS)
  09149 Aging
   04211 Longevity regulating pathway
    102746431 (NRAS)
   04213 Longevity regulating pathway - multiple species
    102746431 (NRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    102746431 (NRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102746431 (NRAS)
   05206 MicroRNAs in cancer
    102746431 (NRAS)
   05205 Proteoglycans in cancer
    102746431 (NRAS)
   05207 Chemical carcinogenesis - receptor activation
    102746431 (NRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    102746431 (NRAS)
   05203 Viral carcinogenesis
    102746431 (NRAS)
   05230 Central carbon metabolism in cancer
    102746431 (NRAS)
   05231 Choline metabolism in cancer
    102746431 (NRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102746431 (NRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102746431 (NRAS)
   05225 Hepatocellular carcinoma
    102746431 (NRAS)
   05226 Gastric cancer
    102746431 (NRAS)
   05214 Glioma
    102746431 (NRAS)
   05216 Thyroid cancer
    102746431 (NRAS)
   05221 Acute myeloid leukemia
    102746431 (NRAS)
   05220 Chronic myeloid leukemia
    102746431 (NRAS)
   05218 Melanoma
    102746431 (NRAS)
   05211 Renal cell carcinoma
    102746431 (NRAS)
   05219 Bladder cancer
    102746431 (NRAS)
   05215 Prostate cancer
    102746431 (NRAS)
   05213 Endometrial cancer
    102746431 (NRAS)
   05224 Breast cancer
    102746431 (NRAS)
   05223 Non-small cell lung cancer
    102746431 (NRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102746431 (NRAS)
   05170 Human immunodeficiency virus 1 infection
    102746431 (NRAS)
   05161 Hepatitis B
    102746431 (NRAS)
   05160 Hepatitis C
    102746431 (NRAS)
   05163 Human cytomegalovirus infection
    102746431 (NRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102746431 (NRAS)
   05165 Human papillomavirus infection
    102746431 (NRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102746431 (NRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    102746431 (NRAS)
  09165 Substance dependence
   05034 Alcoholism
    102746431 (NRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    102746431 (NRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102746431 (NRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102746431 (NRAS)
   01522 Endocrine resistance
    102746431 (NRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lww04131]
    102746431 (NRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lww04147]
    102746431 (NRAS)
   04031 GTP-binding proteins [BR:lww04031]
    102746431 (NRAS)
Membrane trafficking [BR:lww04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    102746431 (NRAS)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    102746431 (NRAS)
Exosome [BR:lww04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102746431 (NRAS)
  Exosomal proteins of other body fluids (saliva and urine)
   102746431 (NRAS)
  Exosomal proteins of breast cancer cells
   102746431 (NRAS)
  Exosomal proteins of colorectal cancer cells
   102746431 (NRAS)
GTP-binding proteins [BR:lww04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    102746431 (NRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N ParA
Other DBs
NCBI-GeneID: 102746431
NCBI-ProteinID: XP_006728512
UniProt: A0A2U3XAI8
LinkDB
Position
Unknown
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSNDDGTQG
CMGLPCVVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgagtacaaactggtggtggttggagcaggtggtgtcgggaaaagcgcgttgaca
atccagctaatccagaaccactttgtagatgagtatgatcccaccatagaggattcttac
cgaaagcaggtggttatagacggtgaaacctgtctgttggacatactggatacagctggt
caagaggagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctctgt
gtatttgccatcaataatagcaaatcatttgcagatattaacctctacagggaacagatt
aagcgagtaaaagattcagatgatgtacctatggtgctagtaggaaataagtgtgatttg
ccaacaaggacagtggacacaaaacaagcccacgaactggccaagagttatgggattcca
ttcattgaaacctcagccaagaccagacagggtgtcgaagatgccttttacacactggta
agagaaatacgtcagtaccgaatgaagaaactcaacagcaatgatgatggaactcaaggt
tgtatggggttaccgtgtgtggtgatgtaa

DBGET integrated database retrieval system