Leptonychotes weddellii (Weddell seal): 102746431 Help Entry 102746431         CDS       T08708                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism lww  Leptonychotes weddellii (Weddell seal) Pathway lww01521   EGFR tyrosine kinase inhibitor resistance lww01522   Endocrine resistance lww04010   MAPK signaling pathway lww04012   ErbB signaling pathway lww04014   Ras signaling pathway lww04015   Rap1 signaling pathway lww04062   Chemokine signaling pathway lww04068   FoxO signaling pathway lww04071   Sphingolipid signaling pathway lww04072   Phospholipase D signaling pathway lww04137   Mitophagy - animal lww04140   Autophagy - animal lww04150   mTOR signaling pathway lww04151   PI3K-Akt signaling pathway lww04210   Apoptosis lww04211   Longevity regulating pathway lww04213   Longevity regulating pathway - multiple species lww04218   Cellular senescence lww04360   Axon guidance lww04370   VEGF signaling pathway lww04371   Apelin signaling pathway lww04540   Gap junction lww04550   Signaling pathways regulating pluripotency of stem cells lww04625   C-type lectin receptor signaling pathway lww04650   Natural killer cell mediated cytotoxicity lww04660   T cell receptor signaling pathway lww04662   B cell receptor signaling pathway lww04664   Fc epsilon RI signaling pathway lww04714   Thermogenesis lww04720   Long-term potentiation lww04722   Neurotrophin signaling pathway lww04725   Cholinergic synapse lww04726   Serotonergic synapse lww04730   Long-term depression lww04810   Regulation of actin cytoskeleton lww04910   Insulin signaling pathway lww04912   GnRH signaling pathway lww04915   Estrogen signaling pathway lww04916   Melanogenesis lww04917   Prolactin signaling pathway lww04919   Thyroid hormone signaling pathway lww04921   Oxytocin signaling pathway lww04926   Relaxin signaling pathway lww04929   GnRH secretion lww04933   AGE-RAGE signaling pathway in diabetic complications lww04935   Growth hormone synthesis, secretion and action lww05010   Alzheimer disease lww05022   Pathways of neurodegeneration - multiple diseases lww05034   Alcoholism lww05160   Hepatitis C lww05161   Hepatitis B lww05163   Human cytomegalovirus infection lww05165   Human papillomavirus infection lww05166   Human T-cell leukemia virus 1 infection lww05167   Kaposi sarcoma-associated herpesvirus infection lww05170   Human immunodeficiency virus 1 infection lww05200   Pathways in cancer lww05203   Viral carcinogenesis lww05205   Proteoglycans in cancer lww05206   MicroRNAs in cancer lww05207   Chemical carcinogenesis - receptor activation lww05208   Chemical carcinogenesis - reactive oxygen species lww05210   Colorectal cancer lww05211   Renal cell carcinoma lww05213   Endometrial cancer lww05214   Glioma lww05215   Prostate cancer lww05216   Thyroid cancer lww05218   Melanoma lww05219   Bladder cancer lww05220   Chronic myeloid leukemia lww05221   Acute myeloid leukemia lww05223   Non-small cell lung cancer lww05224   Breast cancer lww05225   Hepatocellular carcinoma lww05226   Gastric cancer lww05230   Central carbon metabolism in cancer lww05231   Choline metabolism in cancer lww05235   PD-L1 expression and PD-1 checkpoint pathway in cancer lww05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:lww00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102746431 (NRAS)    04012 ErbB signaling pathway     102746431 (NRAS)    04014 Ras signaling pathway     102746431 (NRAS)    04015 Rap1 signaling pathway     102746431 (NRAS)    04370 VEGF signaling pathway     102746431 (NRAS)    04371 Apelin signaling pathway     102746431 (NRAS)    04068 FoxO signaling pathway     102746431 (NRAS)    04072 Phospholipase D signaling pathway     102746431 (NRAS)    04071 Sphingolipid signaling pathway     102746431 (NRAS)    04151 PI3K-Akt signaling pathway     102746431 (NRAS)    04150 mTOR signaling pathway     102746431 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102746431 (NRAS)    04137 Mitophagy - animal     102746431 (NRAS)   09143 Cell growth and death    04210 Apoptosis     102746431 (NRAS)    04218 Cellular senescence     102746431 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     102746431 (NRAS)    04550 Signaling pathways regulating pluripotency of stem cells     102746431 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     102746431 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     102746431 (NRAS)    04650 Natural killer cell mediated cytotoxicity     102746431 (NRAS)    04660 T cell receptor signaling pathway     102746431 (NRAS)    04662 B cell receptor signaling pathway     102746431 (NRAS)    04664 Fc epsilon RI signaling pathway     102746431 (NRAS)    04062 Chemokine signaling pathway     102746431 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     102746431 (NRAS)    04929 GnRH secretion     102746431 (NRAS)    04912 GnRH signaling pathway     102746431 (NRAS)    04915 Estrogen signaling pathway     102746431 (NRAS)    04917 Prolactin signaling pathway     102746431 (NRAS)    04921 Oxytocin signaling pathway     102746431 (NRAS)    04926 Relaxin signaling pathway     102746431 (NRAS)    04935 Growth hormone synthesis, secretion and action     102746431 (NRAS)    04919 Thyroid hormone signaling pathway     102746431 (NRAS)    04916 Melanogenesis     102746431 (NRAS)   09156 Nervous system    04725 Cholinergic synapse     102746431 (NRAS)    04726 Serotonergic synapse     102746431 (NRAS)    04720 Long-term potentiation     102746431 (NRAS)    04730 Long-term depression     102746431 (NRAS)    04722 Neurotrophin signaling pathway     102746431 (NRAS)   09158 Development and regeneration    04360 Axon guidance     102746431 (NRAS)   09149 Aging    04211 Longevity regulating pathway     102746431 (NRAS)    04213 Longevity regulating pathway - multiple species     102746431 (NRAS)   09159 Environmental adaptation    04714 Thermogenesis     102746431 (NRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102746431 (NRAS)    05206 MicroRNAs in cancer     102746431 (NRAS)    05205 Proteoglycans in cancer     102746431 (NRAS)    05207 Chemical carcinogenesis - receptor activation     102746431 (NRAS)    05208 Chemical carcinogenesis - reactive oxygen species     102746431 (NRAS)    05203 Viral carcinogenesis     102746431 (NRAS)    05230 Central carbon metabolism in cancer     102746431 (NRAS)    05231 Choline metabolism in cancer     102746431 (NRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     102746431 (NRAS)   09162 Cancer: specific types    05210 Colorectal cancer     102746431 (NRAS)    05225 Hepatocellular carcinoma     102746431 (NRAS)    05226 Gastric cancer     102746431 (NRAS)    05214 Glioma     102746431 (NRAS)    05216 Thyroid cancer     102746431 (NRAS)    05221 Acute myeloid leukemia     102746431 (NRAS)    05220 Chronic myeloid leukemia     102746431 (NRAS)    05218 Melanoma     102746431 (NRAS)    05211 Renal cell carcinoma     102746431 (NRAS)    05219 Bladder cancer     102746431 (NRAS)    05215 Prostate cancer     102746431 (NRAS)    05213 Endometrial cancer     102746431 (NRAS)    05224 Breast cancer     102746431 (NRAS)    05223 Non-small cell lung cancer     102746431 (NRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102746431 (NRAS)    05170 Human immunodeficiency virus 1 infection     102746431 (NRAS)    05161 Hepatitis B     102746431 (NRAS)    05160 Hepatitis C     102746431 (NRAS)    05163 Human cytomegalovirus infection     102746431 (NRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     102746431 (NRAS)    05165 Human papillomavirus infection     102746431 (NRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     102746431 (NRAS)    05022 Pathways of neurodegeneration - multiple diseases     102746431 (NRAS)   09165 Substance dependence    05034 Alcoholism     102746431 (NRAS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102746431 (NRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     102746431 (NRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     102746431 (NRAS)    01522 Endocrine resistance     102746431 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lww04131]     102746431 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lww04147]     102746431 (NRAS)    04031 GTP-binding proteins [BR:lww04031]     102746431 (NRAS) Membrane trafficking [BR:lww04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     102746431 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     102746431 (NRAS) Exosome [BR:lww04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102746431 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    102746431 (NRAS)   Exosomal proteins of breast cancer cells    102746431 (NRAS)   Exosomal proteins of colorectal cancer cells    102746431 (NRAS) GTP-binding proteins [BR:lww04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     102746431 (NRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N ParA Motif Other DBs NCBI-GeneID:  102746431 NCBI-ProteinID:  XP_006728512 UniProt:  A0A2U3XAI8 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSNDDGTQG CMGLPCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgagtacaaactggtggtggttggagcaggtggtgtcgggaaaagcgcgttgaca atccagctaatccagaaccactttgtagatgagtatgatcccaccatagaggattcttac cgaaagcaggtggttatagacggtgaaacctgtctgttggacatactggatacagctggt caagaggagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctctgt gtatttgccatcaataatagcaaatcatttgcagatattaacctctacagggaacagatt aagcgagtaaaagattcagatgatgtacctatggtgctagtaggaaataagtgtgatttg ccaacaaggacagtggacacaaaacaagcccacgaactggccaagagttatgggattcca ttcattgaaacctcagccaagaccagacagggtgtcgaagatgccttttacacactggta agagaaatacgtcagtaccgaatgaagaaactcaacagcaatgatgatggaactcaaggt tgtatggggttaccgtgtgtggtgatgtaa

DBGET integrated database retrieval system