Leptonychotes weddellii (Weddell seal): 102746547 Help Entry 102746547         CDS       T08708                                  Name (RefSeq) histone H3   KO K11253   histone H3 Organism lww  Leptonychotes weddellii (Weddell seal) Pathway lww04613   Neutrophil extracellular trap formation lww05034   Alcoholism lww05202   Transcriptional misregulation in cancer lww05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:lww00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102746547  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     102746547   09163 Immune disease    05322 Systemic lupus erythematosus     102746547   09165 Substance dependence    05034 Alcoholism     102746547  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:lww03036]     102746547   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lww04147]     102746547 Chromosome and associated proteins [BR:lww03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102746547 Exosome [BR:lww04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102746547 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  102746547 NCBI-ProteinID:  XP_030877304 UniProt:  A0A2U3Z2M3 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgcacgaagcagaccgcccgcaagtcgaccggtggcaaggccccgcgcaagcag ctggccaccaaggcggcccgcaagagcgcgccggccacgggcggcgtgaagaagccgcac cgctaccggccgggcaccgtggccctgcgcgagatccggcgctaccagaagtccaccgag ctgctgatccgcaagctgccgttccagcggctggtgcgcgagatcgcgcaggacttcaag acggacctgcgcttccagagctcggccgtgatggcgctgcaggaggcgagcgaggcctac ctggtggggctgttcgaggacacgaacctgtgcgccatccacgccaagcgcgtcaccatc atgcccaaggacatccagctggcccgccgcatccgcggggagcgggcttaa

DBGET integrated database retrieval system