Leptonychotes weddellii (Weddell seal): 102747573 Help Entry 102747573         CDS       T08708                                  Name (RefSeq) histone H2B type 1-K   KO K11252   histone H2B Organism lww  Leptonychotes weddellii (Weddell seal) Pathway lww04613   Neutrophil extracellular trap formation lww05034   Alcoholism lww05203   Viral carcinogenesis lww05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:lww00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102747573  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     102747573   09163 Immune disease    05322 Systemic lupus erythematosus     102747573   09165 Substance dependence    05034 Alcoholism     102747573  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:lww03036]     102747573   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lww04147]     102747573 Chromosome and associated proteins [BR:lww03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102747573 Exosome [BR:lww04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102747573 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa Motif Other DBs NCBI-GeneID:  102747573 NCBI-ProteinID:  XP_006735972 UniProt:  A0A2U3XX77 LinkDB All DBs Position Unknown AA seq 126 aa AA seqDB search MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSAK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcctgaacccgccaagtcggctccggccccgaagaagggctccaagaaggcggtgacc aaggcgcagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactcggtg tacgtgtacaaggtgctgaagcaggtgcaccccgacacgggcatctcgtccaaggccatg ggcatcatgaactcgttcgtcaacgacatcttcgagcgcatcgcgggcgaggcgtcccgc ctggcgcattacaacaagcgctcgaccatcacgtcgcgggagatccagacggccgtgcgc ctgctgctgccgggggagctggccaagcacgccgtgtccgagggcaccaaggccgtcacc aagtacaccagcgccaagtga

DBGET integrated database retrieval system