Leptonychotes weddellii (Weddell seal): 102750111 Help Entry 102750111         CDS       T08708                                  Symbol RAB1A Name (RefSeq) ras-related protein Rab-1A   KO K07874   Ras-related protein Rab-1A Organism lww  Leptonychotes weddellii (Weddell seal) Pathway lww04140   Autophagy - animal lww05014   Amyotrophic lateral sclerosis lww05022   Pathways of neurodegeneration - multiple diseases lww05134   Legionellosis Brite KEGG Orthology (KO) [BR:lww00001]  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102750111 (RAB1A)  09160 Human Diseases   09171 Infectious disease: bacterial    05134 Legionellosis     102750111 (RAB1A)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     102750111 (RAB1A)    05022 Pathways of neurodegeneration - multiple diseases     102750111 (RAB1A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lww04131]     102750111 (RAB1A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lww04147]     102750111 (RAB1A)    04031 GTP-binding proteins [BR:lww04031]     102750111 (RAB1A) Membrane trafficking [BR:lww04131]  Endoplasmic reticulum (ER) - Golgi transport   Forward pathways    Rab GTPases     102750111 (RAB1A)  Autophagy   Other autophagy associated proteins     102750111 (RAB1A) Exosome [BR:lww04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102750111 (RAB1A)   Exosomal proteins of other body fluids (saliva and urine)    102750111 (RAB1A)   Exosomal proteins of colorectal cancer cells    102750111 (RAB1A) GTP-binding proteins [BR:lww04031]  Small (monomeric) G-proteins   Rab Family    Rab1/35 [OT]     102750111 (RAB1A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 Gtr1_RagA SRPRB FeoB_N AAA ABC_tran AAA_7 PduV-EutP AAA_16 LANC_like AAA_29 Septin AAA_22 AAA_5 CRAL_TRIO_2 Motif Other DBs NCBI-GeneID:  102750111 NCBI-ProteinID:  XP_006748470 UniProt:  A0A2U3YXK7 LinkDB All DBs Position Unknown AA seq 205 aa AA seqDB search MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTI KLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKL LVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGA TAGGAEKSNVKIQSTPVKQSGGGCC NT seq 618 nt NT seq  +upstreamnt  +downstreamnt atgtccagcatgaatcccgaatatgattatttattcaagttacttctgattggcgactct ggggttggaaagtcttgcctccttcttaggtttgcagatgatacatatacagaaagctac atcagcacaattggtgtggatttcaaaataagaactatagagttagatgggaaaacaatc aagcttcaaatatgggacacagcaggccaagaaagattccgaacaatcacctccagttat tacagaggagcccacggcatcatagttgtgtatgatgtgacagatcaggagtccttcaat aatgttaagcagtggctgcaggaaatagaccgttacgccagtgaaaacgtcaacaagttg ttggtagggaacaaatgcgatctgaccacaaagaaagtagtagactacacaacagcaaag gaatttgctgattcccttggaattccatttttggaaaccagtgctaagaacgcaacgaat gtagaacagtctttcatgacgatggcagctgagattaaaaagcgaatgggtcctggagca acagctggtggtgcagagaagtccaatgtgaaaattcagagcactccggtcaagcagtca ggtggaggttgctgctaa

DBGET integrated database retrieval system