Leptonychotes weddellii (Weddell seal): 102750242 Help Entry 102750242         CDS       T08708                                  Name (RefSeq) ubiquitin-like   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism lww  Leptonychotes weddellii (Weddell seal) Pathway lww03010   Ribosome lww04120   Ubiquitin mediated proteolysis lww04137   Mitophagy - animal lww04140   Autophagy - animal lww05012   Parkinson disease lww05022   Pathways of neurodegeneration - multiple diseases lww05167   Kaposi sarcoma-associated herpesvirus infection lww05171   Coronavirus disease - COVID-19 Brite KEGG Orthology (KO) [BR:lww00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     102750242   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     102750242  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102750242    04137 Mitophagy - animal     102750242  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     102750242    05167 Kaposi sarcoma-associated herpesvirus infection     102750242   09164 Neurodegenerative disease    05012 Parkinson disease     102750242    05022 Pathways of neurodegeneration - multiple diseases     102750242  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:lww03011]     102750242    04121 Ubiquitin system [BR:lww04121]     102750242 Ribosome [BR:lww03011]  Ribosomal proteins   Eukaryotes    Large subunit     102750242   Archaea     102750242 Ubiquitin system [BR:lww04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    102750242 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_L40e ubiquitin Rad60-SLD DUF2604 Motif Other DBs NCBI-GeneID:  102750242 NCBI-ProteinID:  XP_030886697 UniProt:  A0A7F8R003 LinkDB All DBs Position Unknown AA seq 118 aa AA seqDB search MQISVKTLTARPTFSRSSRDTTENVKAKIHDKDGIPPNQGKQLEDGRTVSDYNIQKEATL YLGLHLQGGIIEPSLCQLAQKYNRDKMMRCKCSTRLHPRGHLPQEVRHTNNLCPKKIK NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atgcagatctctgtgaagaccctgacagcaagaccaacattctcgaggtcgagccgtgac accactgagaatgttaaagccaaaatccatgacaaggacggcatcccgcccaaccagggc aaacagctggaggatggccgcactgtctcagactacaatatccagaaggaggccaccctg tacttggggcttcacctgcagggtggcatcatcgagccttccctctgccagctggcccag aaatacaaccgtgacaagatgatgcgctgcaagtgttctactcgcctgcacccccgcggt cacctgccgcaggaagtgcgccacaccaacaacctgtgccccaagaagatcaaataa

DBGET integrated database retrieval system