Leptonychotes weddellii (Weddell seal): 102751032 Help Entry 102751032         CDS       T08708                                  Symbol IL5 Name (RefSeq) interleukin-5   KO K05428   interleukin 5 Organism lww  Leptonychotes weddellii (Weddell seal) Pathway lww04060   Cytokine-cytokine receptor interaction lww04630   JAK-STAT signaling pathway lww04640   Hematopoietic cell lineage lww04657   IL-17 signaling pathway lww04658   Th1 and Th2 cell differentiation lww04660   T cell receptor signaling pathway lww04664   Fc epsilon RI signaling pathway lww04672   Intestinal immune network for IgA production lww05200   Pathways in cancer lww05310   Asthma lww05320   Autoimmune thyroid disease lww05321   Inflammatory bowel disease lww05330   Allograft rejection Brite KEGG Orthology (KO) [BR:lww00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     102751032 (IL5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102751032 (IL5)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     102751032 (IL5)    04660 T cell receptor signaling pathway     102751032 (IL5)    04658 Th1 and Th2 cell differentiation     102751032 (IL5)    04657 IL-17 signaling pathway     102751032 (IL5)    04664 Fc epsilon RI signaling pathway     102751032 (IL5)    04672 Intestinal immune network for IgA production     102751032 (IL5)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102751032 (IL5)   09163 Immune disease    05310 Asthma     102751032 (IL5)    05320 Autoimmune thyroid disease     102751032 (IL5)    05321 Inflammatory bowel disease     102751032 (IL5)    05330 Allograft rejection     102751032 (IL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:lww04052]     102751032 (IL5)    00536 Glycosaminoglycan binding proteins [BR:lww00536]     102751032 (IL5) Cytokines and neuropeptides [BR:lww04052]  Cytokines   Interleukins    102751032 (IL5) Glycosaminoglycan binding proteins [BR:lww00536]  Heparan sulfate / Heparin   Cytokines    102751032 (IL5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL5 DUF4301 Motif Other DBs NCBI-GeneID:  102751032 NCBI-ProteinID:  XP_006734747 UniProt:  A0A2U3XTG3 LinkDB All DBs Position Unknown AA seq 134 aa AA seqDB search MRMLLHLSLLALGAAYVSVTAVESTMNRLVAETLTLLSVHRTLLIGDGNLMIPTPEHKNH QLCIEEVFQGIDILKNRTAQGEAVDKLFQNLSFIKQHIDLQKKRCGGERWRVEKFLDHLQ VFLGVINTEWTTES NT seq 405 nt NT seq  +upstreamnt  +downstreamnt atgagaatgcttctgcatttgagtttgctagctcttggggctgcctatgtttctgtcact gctgtagaaagtaccatgaatagactggttgcagaaacgttgacactgctctccgttcat cgaactctgctgataggcgatgggaacctgatgattcctactcctgaacataaaaatcac cagttgtgcattgaagaagtctttcagggtatagacatactgaagaaccgaactgcacaa ggggaggctgtggataaactattccaaaacttgtctttcataaaacaacacatagacctc caaaaaaaaaggtgtggaggagaaagatggagagtagaaaagttcctagaccacctgcaa gtgtttcttggtgtcataaacaccgagtggacaacagaaagttga

DBGET integrated database retrieval system