Leptonychotes weddellii (Weddell seal): 4355838 Help Entry 4355838           CDS       T08708                                  Symbol ND6 Name (RefSeq) NADH dehydrogenase subunit 6   KO K03884   NADH-ubiquinone oxidoreductase chain 6 [EC:7.1.1.2] Organism lww  Leptonychotes weddellii (Weddell seal) Pathway lww00190   Oxidative phosphorylation lww01100   Metabolic pathways lww04714   Thermogenesis lww04723   Retrograde endocannabinoid signaling lww05010   Alzheimer disease lww05012   Parkinson disease lww05014   Amyotrophic lateral sclerosis lww05016   Huntington disease lww05020   Prion disease lww05022   Pathways of neurodegeneration - multiple diseases lww05208   Chemical carcinogenesis - reactive oxygen species lww05415   Diabetic cardiomyopathy Module lww_M00142   NADH:ubiquinone oxidoreductase, mitochondria Brite KEGG Orthology (KO) [BR:lww00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     4355838 (ND6)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     4355838 (ND6)   09159 Environmental adaptation    04714 Thermogenesis     4355838 (ND6)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     4355838 (ND6)   09164 Neurodegenerative disease    05010 Alzheimer disease     4355838 (ND6)    05012 Parkinson disease     4355838 (ND6)    05014 Amyotrophic lateral sclerosis     4355838 (ND6)    05016 Huntington disease     4355838 (ND6)    05020 Prion disease     4355838 (ND6)    05022 Pathways of neurodegeneration - multiple diseases     4355838 (ND6)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     4355838 (ND6)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:lww03029]     4355838 (ND6) Enzymes [BR:lww01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      4355838 (ND6) Mitochondrial biogenesis [BR:lww03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA-encoded proteins    Mitochondrial respiratory chain complex I     4355838 (ND6) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Oxidored_q3 DUF6600 Motif Other DBs NCBI-GeneID:  4355838 NCBI-ProteinID:  YP_778810 UniProt:  Q08H99 LinkDB All DBs Position MT AA seq 175 aa AA seqDB search MMTYIVFILSVIFVVSFVGFSSKPSPIYGGLVLIVGGAVGCGIVLSFGGSFLGLMVFLIY LGGMLVVFGYTTAMATEQYPEVWISNKAVLGAFVMGLLSELLLACYILKDDEVDLVFEFN GMGDWVIYDTGDSGFFSEEAMGIAALYSYGTWLVIVTGWSLLTGVLVIMEVTRGN NT seq 528 nt NT seq  +upstreamnt  +downstreamnt atgataacgtatattgtatttatcttgagtgttatttttgtagttagttttgtaggtttt tcttctaagccttctcctatttatggtgggcttgttttgattgttggtggggctgttggt tgtggtattgtgttgagttttggagggtcttttttaggtttgatagtttttttaatttat ttggggggtatacttgttgtttttggttatactactgctatggctaccgagcagtatcct gaggtttggatttctaataaggctgtgttgggtgcgtttgttataggtctgttgtcagag ttattgcttgcttgctatattttaaaggatgatgaggttgatcttgtgtttgagtttaat ggtataggggattgggtaatttatgatacgggagattcagggttctttagtgaggaagct atgggtattgcggctttgtatagttatggtacttgattggttattgtgactggttgatct cttcttacaggagtgttggtgattatggaagttactcgtggaaattaa

DBGET integrated database retrieval system