Lentzea xerophila: ACRSBM_15090 Help Entry ACRSBM_15090      CDS       T11210                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism lxr  Lentzea xerophila Pathway lxr00998   Biosynthesis of various antibiotics lxr01100   Metabolic pathways lxr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:lxr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ACRSBM_15090    00074 Mycolic acid biosynthesis     ACRSBM_15090   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ACRSBM_15090 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  XWW37885 LinkDB All DBs Position 3120692..3120952 Genome browser AA seq 86 aa AA seqDB search MSEHVQEKIKTVLAAVLANGIEPAGISSDADLVDDYGLDSLQMISFLLGIEDTFDVALDY ENLELDDLRSVRQFADFVSRLAPIAR NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgtccgagcatgtccaggagaagatcaagaccgtcctggcggcggtgctcgccaacggg atcgagcccgccggcatctcgtccgacgccgacctggtggacgactacgggctcgactca ctgcagatgatctcgttcctgctcggcatcgaggacaccttcgacgtcgcgctcgactac gagaacctcgaactggacgacctgcggtccgtgcggcagttcgcggacttcgtgagccgg ctggcaccgatcgcccgatga

DBGET integrated database retrieval system